y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna06378.1-v1.0-hybrid
FamilyGH1
Protein PropertiesLength: 509 Molecular Weight: 57395.9 Isoelectric Point: 7.1395
ChromosomeChromosome/Scaffold: 5 Start: 4978033 End: 4980799
Descriptionbeta glucosidase 13
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH1605030
  KSDFPTDFAFGVGSSAAQIEGAAREFGRGPSTWDHRVDILPGSIHDSDKLSTAIDSYRRYKQDIELIKDLGVDSYRFSISWSRILPYGSLSGGINQQGVD
  HYNSLIDELIKNGIKPYVTIFHFDLPQALEEKYGGFLNRSFVDDFRDYSELCFKLFGDRVKNWFTINEPSVSAVYGYELGIAPPGKCSLQEGVCVFGTSD
  NCLVPAGPCNFGGNSSTDPYIAAHNQILAHATAAKLYKEKYQSTHKGEIGIVLVSRHYMPFTKKQEDIAAAKRRFDFTLGWFMDPFVYGDYPKSMKELVK
  ERLPTFSPEEQSLIKGSLDFVGINYYSSTYARNKAPSKELRYSYDVSADEIGLSTTRNDELPFADQLKDPERIAYIVRHLYRINKAIKKGVNVKGYFFWA
  MFDDFEWGMGFLDRFGLYHIDFAHNYRRTPKHSAKWFKAFLQSK
Full Sequence
Protein Sequence     Length: 509     Download
MASSTYALIA LFAMVSIAGW PVQATWDGVV PVEANLTVGG YTFRLNLNSP AYLEELNVTK    60
SDFPTDFAFG VGSSAAQIEG AAREFGRGPS TWDHRVDILP GSIHDSDKLS TAIDSYRRYK    120
QDIELIKDLG VDSYRFSISW SRILPYGSLS GGINQQGVDH YNSLIDELIK NGIKPYVTIF    180
HFDLPQALEE KYGGFLNRSF VDDFRDYSEL CFKLFGDRVK NWFTINEPSV SAVYGYELGI    240
APPGKCSLQE GVCVFGTSDN CLVPAGPCNF GGNSSTDPYI AAHNQILAHA TAAKLYKEKY    300
QSTHKGEIGI VLVSRHYMPF TKKQEDIAAA KRRFDFTLGW FMDPFVYGDY PKSMKELVKE    360
RLPTFSPEEQ SLIKGSLDFV GINYYSSTYA RNKAPSKELR YSYDVSADEI GLSTTRNDEL    420
PFADQLKDPE RIAYIVRHLY RINKAIKKGV NVKGYFFWAM FDDFEWGMGF LDRFGLYHID    480
FAHNYRRTPK HSAKWFKAFL QSKVARAS*                                      540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02814PLN028141.0e-11559508489+
PLN02849PLN028492.0e-11659503485+
COG2723BglB2.0e-12563502482+
TIGR03356BGL6.0e-13064496463+
pfam00232Glyco_hydro_13.0e-15263503483+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3ptq_B05550026503A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose
PDB3ptq_A05550026503A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose
PDB3ptm_B05550026503A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose
PDB3ptm_A05550026503A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose
PDB3ptk_B05550026503A Chain A, The Crystal Structure Of Rice (Oryza Sativa L.) Os4bglu12
Signal Peptide
Cleavage Site
24
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_007_00603.1Aquca_011_00256.1Aquca_011_00258.1Aquca_011_00256.2Aquca_007_00604.1
Fragaria vescamrna06376.1-v1.0-hybrid
Malus domesticaMDP0000239732MDP0000143078MDP0000303677MDP0000235546
Manihot esculentacassava4.1_026312m
Picea abiesMA_70066g0010
Prunus persicappa027074m
Ricinus communis30147.m01453830147.m014539
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny