y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna06416.1-v1.0-hybrid
FamilyGH38
Protein PropertiesLength: 2031 Molecular Weight: 228878 Isoelectric Point: 6.2752
ChromosomeChromosome/Scaffold: 5 Start: 4077966 End: 4091772
DescriptionGlycosyl hydrolase family 38 protein
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH38393510
  NVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDSLIPALLADKNRKFVYVEQAFFQRWWRDQSEEVQDTVKELVSSGQLELINGGMCMHDEAAP
  HYIDMIDQTTLGHRFIKQEFNVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLFFGRIDYQDRAKRKVDKSLEVVWRGSKSLGSSAQIFAGAFPANYEPPS
  DNFYFEVNDASPIVQDDMDLFDYNVPDRVNDFVSAAMLQANITRTNHIMWTMGTDFKYQYAHTWFRQMDKFINYVNQDGRVNALYSTPSIYTDAKYAADE
  SWPIKSDDFFPYA
GH38107513890
  NVHLVPHTHDDVGWVKTVDQYYTGANNSLLGSPASVRNVLDSLVPALLADKNRKFIYAEQAFFQLWWREQSEAIQDTVKQLVSSGQLEFINGGMCMHDEA
  ATHYIDMIDQTTLGHRFIKQEFNVTPRVGWQIDTFGHSSVQAYLLGAEVGFDSLFFGRIDYQDKAKRKDDKSLEVVWRGSKSLGSSAQIFAGAFPGLYVP
  PSDNFYFETDDPAPLVQDDMNLGDYNMPERVNDFVSEAISQANITRTNHIMWTMGKDFAYQYANSWFRQMDKFIHHVNQDGRVNALYSTPSMYTNAKYAT
  NESWPIKSDDFFPYA
Full Sequence
Protein Sequence     Length: 2031     Download
MAVVAYFPVV LVFTVFLYAA EAKYIQYNTT SVLVPGKLNV HLVPHTHDDV GWLKTVDQYY    60
VGSNNSIQGA CVQNVLDSLI PALLADKNRK FVYVEQAFFQ RWWRDQSEEV QDTVKELVSS    120
GQLELINGGM CMHDEAAPHY IDMIDQTTLG HRFIKQEFNV TPRIGWQIDP FGHSAVQAYL    180
LGAEVGFDSL FFGRIDYQDR AKRKVDKSLE VVWRGSKSLG SSAQIFAGAF PANYEPPSDN    240
FYFEVNDASP IVQDDMDLFD YNVPDRVNDF VSAAMLQANI TRTNHIMWTM GTDFKYQYAH    300
TWFRQMDKFI NYVNQDGRVN ALYSTPSIYT DAKYAADESW PIKSDDFFPY ADNINAYWTG    360
YFTSRPALKG YVRVMGGYYL AARQLEFFKG RSKSGPNTEY LADALAIAQH HDAVSGTSKQ    420
HVADDYAKRL SIGYVETEKV VAKSLACMTE PSQAGCKSVC PLLNISYCPS SEVHLSKGKD    480
LVIVVYNSLG WKRKDVIKIP VVSEHVTVKD SAGKEIELQI LPLLNESLSI RNNLVKAYLG    540
ISPSVTPSYW LAFSATVPPL GFSTYIVSSA KQTATTERLT LHKTELSQNN EIKVGPGNLK    600
LIYSGNDGKL IEYTNSRSSV KELVDQSFSY YPGDDGTHAN KTDLQASGAY IFRPNGTYPI    660
NSEGEVPLTV LRGPLLDEVH QKINSWIYQV TRVYKEKEHA EIEFTVGPIP IDDGIGKEIV    720
TKITTSMKTN KQFYTDSNGR DFIERIRDYR KDWTLEVNQP VAGNYYPINL GIYAKDNNTE    780
MSVLVDRSVG GSSIVDGQLE LMIHRRLLYD DARGVGEALN ETVCIQDDCK GLTVTGKYYL    840
RLDPIGEGAK WRRSFGQEIY SPFLLAFTEQ DGHRWTKSHV TTFSGMDPSY SLPDNVAIIT    900
IQELEDGKVL FRLAHLYEIE EDKDLSVMAS VELKKVFANK KIKQITEMSL SANQGRAEME    960
KKRLVWKVEG SSEEPKALRG GPVDPTKLVF FRCHWSSAQP LLNCRAFMPL IVRGTNIGLE    1020
VSIVSAFLNI QVLGTSMAVE ACCLRLLMVL VVFLFAESKF IAYNTTSQIV PGKLNVHLVP    1080
HTHDDVGWVK TVDQYYTGAN NSLLGSPASV RNVLDSLVPA LLADKNRKFI YAEQAFFQLW    1140
WREQSEAIQD TVKQLVSSGQ LEFINGGMCM HDEAATHYID MIDQTTLGHR FIKQEFNVTP    1200
RVGWQIDTFG HSSVQAYLLG AEVGFDSLFF GRIDYQDKAK RKDDKSLEVV WRGSKSLGSS    1260
AQIFAGAFPG LYVPPSDNFY FETDDPAPLV QDDMNLGDYN MPERVNDFVS EAISQANITR    1320
TNHIMWTMGK DFAYQYANSW FRQMDKFIHH VNQDGRVNAL YSTPSMYTNA KYATNESWPI    1380
KSDDFFPYAS DVNAYWTGYF TSRPALKRYV RMMSSYYLAA RQLEFFKGIR KSGPNTDSLA    1440
DALAVAQHHD AVSGTSRQHV ADDYTKRLYI GYKEAEKCPL LNISYCPPSE VDLTKGKDLV    1500
IVVYNPLGWR RKDVIRIPVV NENVTVKDST GKKVESQILP LLNASVSIRD YHVKAYLGIA    1560
PSVTPSYWLA FSATVPPLGF STYIVSNDLN IAATTSKRHT VYKTETSQDE TIKVGPGNLK    1620
LIYSGNDGEL IQYTNSRSLV KESVKQSFSY YPGDDGSVVD SYGEDGNPRF QASGAYIFRP    1680
NGTYPIKSKE QVSLTVLRGP LLDEVHQRIN SWIYQVTRVY KEKEHAEIEF IIGPIPADDG    1740
IGKEIVTKIT TSMRTNKQFY TDSNGRDFIQ RIRDYRKDWN LEVNQPVAGN YHPINLGIYM    1800
KDNNTELSVL VDRSVGGSSI VDGQLELMLH RRLLADDDKG IAEQLNETVC IQDDCKGLTI    1860
TGKYHMRIDP LGEGAKWRRS FGQEIYSPFL LAFTEKDGDN WTSSHVTTFS GMDPSYALPD    1920
NIALLTLQEL EDGKVLLRLA HLYEIEEDKD LSVMASVELK KVFANKKIKH ITEMSLTANQ    1980
DRREMERKRL VWNVEGSNKE PKALRGGAVD PTKLVVDLAP MEIRTFIVNF *             2040
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02701PLN027013.0e-9437817878+
cd00451GH38N_AMII_euk3.0e-9910741352279+
cd00451GH38N_AMII_euk4.0e-10038314277+
cd10810GH38N_AMII_LAM_like1.0e-15710741353282+
cd10810GH38N_AMII_LAM_like3.0e-16738315280+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0004559alpha-mannosidase activity
GO:0005975carbohydrate metabolic process
GO:0006013mannose metabolic process
GO:0008270zinc ion binding
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1o7d_A0273213298C Chain C, The Structure Of The Bovine Lysosomal A-Mannosidase Suggests A Novel Mechanism For Low Ph Activation
PDB1o7d_A0106213592298C Chain C, The Structure Of The Bovine Lysosomal A-Mannosidase Suggests A Novel Mechanism For Low Ph Activation
PDB1hxk_A02581938852A Chain A, Golgi Alpha-Mannosidase Ii In Complex With Deoxymannojirimicin
PDB1hxk_A01073184350850A Chain A, Golgi Alpha-Mannosidase Ii In Complex With Deoxymannojirimicin
PDB1hww_A02581938852A Chain A, Golgi Alpha-Mannosidase Ii In Complex With Deoxymannojirimicin
Transmembrane Domains
StartEnd
220
Signal Peptide
Cleavage Site
22
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_002_00345.1.265.483Aquca_002_00345.1.265.483Aquca_006_00230.1Aquca_006_00257.5Aquca_006_00257.9
Aquca_006_00257.8Aquca_006_00257.7Aquca_006_00257.6Aquca_006_00257.4Aquca_006_00257.3
Aquca_006_00257.2Aquca_006_00257.1Aquca_043_00016.7Aquca_043_00016.8Aquca_043_00016.6
Aquca_043_00016.5Aquca_043_00016.4Aquca_043_00016.3Aquca_043_00016.2Aquca_043_00016.1
Aquca_043_00019.2Aquca_043_00019.1Aquca_043_00018.1Aquca_056_00071.1Aquca_002_00345.1.162.261
Aquca_002_00345.1.162.261
Arabidopsis lyrata488339488225497001484445
Arabidopsis thalianaAT5G14950.1AT5G66150.1AT5G13980.3AT5G13980.2AT5G13980.1
AT3G26720.2AT3G26720.1
Brachypodium distachyonBradi1g44550.1Bradi3g21117.1Bradi4g17327.1Bradi4g17317.1
Brassica rapaBra023496Bra006275Bra037183Bra006227Bra025225
Carica papayaevm.model.supercontig_6.275evm.model.supercontig_70.70evm.model.supercontig_2646.1evm.TU.contig_36966.1evm.model.supercontig_70.69
Capsella rubellaCarubv10000075mCarubv10002909mCarubv10027738mCarubv10016625m
Citrus clementinaCiclev10014083mCiclev10017635mCiclev10024829mCiclev10024800mCiclev10030627m
Ciclev10014156mCiclev10014160mCiclev10014123m
Citrus sinensisorange1.1g002547morange1.1g002518morange1.1g002134morange1.1g001061morange1.1g015028m
orange1.1g002366morange1.1g004057morange1.1g001910morange1.1g001850morange1.1g002764m
orange1.1g002170morange1.1g002162morange1.1g002383morange1.1g001963morange1.1g001813m
orange1.1g002938morange1.1g002542morange1.1g002064morange1.1g002056morange1.1g002046m
orange1.1g002036m
Cucumis sativusCucsa.339310.1Cucsa.043720.1Cucsa.188400.2Cucsa.188400.1
Eucalyptus grandisEucgr.J02166.1Eucgr.L01536.1Eucgr.J02456.1Eucgr.K02195.1Eucgr.J02455.3
Eucgr.J02455.2Eucgr.J02455.1Eucgr.I01600.1Eucgr.G01931.1Eucgr.J02460.1
Eucgr.J02454.1Eucgr.L01537.1Eucgr.J02457.1Eucgr.J02459.2Eucgr.J02459.1
Fragaria vescamrna28330.1-v1.0-hybridmrna14585.1-v1.0-hybridmrna01394.1-v1.0-hybrid.37.348mrna01394.1-v1.0-hybrid.37.348mrna06416.1-v1.0-hybrid.39.351
mrna06416.1-v1.0-hybrid.39.351mrna14589.1-v1.0-hybrid.71.344
Glycine maxGlyma13g04761.3Glyma13g04761.2Glyma19g01890.1Glyma13g04761.1Glyma02g05240.2
Glyma02g05240.1Glyma16g23600.1Glyma01g36980.1Glyma06g17270.1Glyma04g37790.1
Glyma19g27660.2Glyma19g27660.1Glyma16g05240.2Glyma16g05240.1
Gossypium raimondiiGorai.001G258600.2Gorai.001G258600.1Gorai.006G027500.1Gorai.003G008600.2Gorai.003G008600.1
Gorai.006G000300.3Gorai.006G000300.2Gorai.006G000300.1Gorai.012G082700.6Gorai.012G082700.9
Gorai.012G082700.8Gorai.012G082700.7Gorai.012G082700.5Gorai.012G082700.4Gorai.012G082700.3
Gorai.012G082700.2Gorai.012G082700.10Gorai.012G082700.1Gorai.003G116600.2Gorai.003G116600.1
Linum usitatissimumLus10014507Lus10015337.248.571Lus10015337.248.571Lus10032179Lus10039457
Lus10012578Lus10035111Lus10012577Lus10036074Lus10025960
Lus10014259Lus10041516Lus10015337.158.248Lus10015337.158.248
Malus domesticaMDP0000888429MDP0000267909MDP0000250936MDP0000139458MDP0000274501
MDP0000274500MDP0000409920MDP0000163211MDP0000657082MDP0000211018
Manihot esculentacassava4.1_000571mcassava4.1_001602mcassava4.1_000993mcassava4.1_000971mcassava4.1_000869m
cassava4.1_001123mcassava4.1_001106m
Medicago truncatulaMedtr4g071680.1Medtr6g008850.1Medtr8g075330.1Medtr7g084040.1Medtr3g098650.2
Medtr3g098650.1Medtr7g084030.1
Mimulus guttatusmgv1a000435mmgv1a000658mmgv1a000852mmgv1a000690m
Oryza sativaLOC_Os06g13650.2LOC_Os06g13650.1LOC_Os06g13650.3LOC_Os11g32260.2LOC_Os11g32260.1
LOC_Os10g05069.2LOC_Os10g05069.1LOC_Os10g05069.3
Panicum virgatumPavirv00027286mPavirv00014532mPavirv00024149mPavirv00025946mPavirv00065120m
Physcomitrella patensPp1s10_34V6.1Pp1s77_136V6.1Pp1s129_147V6.1
Phaseolus vulgarisPhvul.004G022500.1Phvul.003G264400.1Phvul.001G084400.1Phvul.002G107300.1Phvul.001G084700.1
Phvul.009G161600.1
Picea abiesMA_10434251g0010MA_879613g0010MA_4107059g0010
Populus trichocarpaPotri.017G073900.2Potri.017G073900.1Potri.001G350400.2Potri.001G350400.1Potri.014G143600.1
Potri.014G143600.2Potri.007G056300.1Potri.002G238200.2Potri.002G238200.1Potri.012G106500.2
Potri.012G106500.1
Prunus persicappa000458mppa021513mppa000707mppa000755mppa000717m
Ricinus communis29822.m00342029868.m00034130131.m00698230131.m00698130147.m014412
Setaria italicaSi005719mSi038673mSi025964mSi034056mSi025881m
Selaginella moellendorffii104910154366266756410022178241
Sorghum bicolorSb10g008770.1Sb01g026405.1Sb05g019600.1Sb01g026390.1
Thellungiella halophilaThhalv10012487mThhalv10012612mThhalv10012546mThhalv10003575mThhalv10003577m
Vitis viniferaGSVIVT01032586001GSVIVT01018752001GSVIVT01032988001GSVIVT01008340001GSVIVT01008642001
GSVIVT01032989001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)