y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna06450.1-v1.0-hybrid
FamilyGT29
Protein PropertiesLength: 350 Molecular Weight: 39528.2 Isoelectric Point: 5.5407
ChromosomeChromosome/Scaffold: 5 Start: 4281243 End: 4284292
DescriptionGlycosyltransferase family 29 (sialyltransferase) family protein
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT291442303.6e-29
  LDRCKNKTLCVEKLSLVLPETPPYVPHMFGRCAVIGNSGDLLKTKFGREIDGYDAVVRENGAPIENYADHVGKKCTFRLLNRGSAKA
Full Sequence
Protein Sequence     Length: 350     Download
MRLLRLAFVV ALLFGLVAIL IYITGVSDLY ELNRLTDEDL EALQTLQDRF QKCVAANGLG    60
LQVESSKDSC QVTMKFPRDT IPKWKDPKTD ELEGLSYDFN LCEALVTWEQ VRNSTTILTR    120
EFIDALPNGW EDYAWRRINK GIQLDRCKNK TLCVEKLSLV LPETPPYVPH MFGRCAVIGN    180
SGDLLKTKFG REIDGYDAVV RENGAPIENY ADHVGKKCTF RLLNRGSAKA LDKVVELDAK    240
GTGLKALEFA LSICDSVDMY GFTVDPGYKE WTRYFSESRQ GHTPLHGRAY YQMMECLGED    300
WSRLCNSTTY VFNCKEASQA KAYIIPQTEE GCYRAPEICE KCNPVPSRA*               360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam00777Glyco_transf_292.0e-1324229864+
pfam00777Glyco_transf_294.0e-2614522988+
Gene Ontology
GO TermDescription
GO:0006486protein glycosylation
GO:0008373sialyltransferase activity
GO:0030173integral to Golgi membrane
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2wnf_A0.0000000917425299177A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose
PDB2wnb_A0.0000000917425299177A Chain A, Crystal Structure Of A Mammalian Sialyltransferase In Complex With Disaccharide And Cmp
PDB2wml_A0.0000000917425299177A Chain A, Crystal Structure Of A Mammalian Sialyltransferase
Transmembrane Domains
StartEnd
726
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_004_00108.5Aquca_019_00142.1Aquca_004_00108.4Aquca_004_00108.3Aquca_004_00108.2
Aquca_004_00108.1
Arabidopsis lyrata906136470934
Arabidopsis thalianaAT3G48820.2AT3G48820.1AT1G08660.1AT1G08660.2
Brachypodium distachyonBradi3g01700.2Bradi3g01700.3Bradi3g01700.1Bradi1g67467.1
Brassica rapaBra019569Bra031637
Carica papayaevm.model.supercontig_4.113evm.model.supercontig_70.73
Capsella rubellaCarubv10017505mCarubv10017208mCarubv10009607mCarubv10009038m
Citrus clementinaCiclev10031577mCiclev10031575mCiclev10031902m
Citrus sinensisorange1.1g013814morange1.1g013792morange1.1g017903morange1.1g017882morange1.1g022244m
orange1.1g019465morange1.1g011883m
Cucumis sativusCucsa.014710.2Cucsa.014710.1Cucsa.156010.2Cucsa.156010.1
Eucalyptus grandisEucgr.F04117.1Eucgr.I01604.1Eucgr.G01933.1
Fragaria vescamrna01393.1-v1.0-hybrid
Glycine maxGlyma05g34110.1Glyma08g05580.4Glyma08g05580.3Glyma08g05580.1Glyma08g05580.2
Glyma19g27546.1Glyma16g05340.1
Gossypium raimondiiGorai.008G209800.2Gorai.008G209800.1Gorai.005G137400.2Gorai.005G137400.1Gorai.005G137400.3
Linum usitatissimumLus10032547Lus10043193Lus10035162Lus10031992
Malus domesticaMDP0000239581MDP0000149927MDP0000165459MDP0000211019MDP0000304668
MDP0000244138
Manihot esculentacassava4.1_007830mcassava4.1_008832m
Medicago truncatulaMedtr7g084010.1Medtr8g099840.2Medtr8g099840.1
Mimulus guttatusmgv1a023151mmgv1a005647m
Oryza sativaLOC_Os02g02620.1LOC_Os11g36420.1
Panicum virgatumPavirv00016935mPavirv00068699mPavirv00023972mPavirv00062875mPavirv00062874m
Physcomitrella patensPp1s457_24V6.1Pp1s209_60V6.1
Phaseolus vulgarisPhvul.002G327200.1Phvul.001G084900.1
Picea abiesMA_30391g0010MA_932319g0010
Populus trichocarpaPotri.015G104100.1Potri.014G145400.2Potri.014G145400.1
Prunus persicappa005917mppa005273m
Ricinus communis30147.m01442930131.m006986
Setaria italicaSi017190mSi026296m
Selaginella moellendorffii406168831178267676584403717
760757656779823
Sorghum bicolorSb04g001370.1Sb05g022210.1
Thellungiella halophilaThhalv10010382mThhalv10007525m
Vitis viniferaGSVIVT01008625001GSVIVT01032992001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)