y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna06587.1-v1.0-hybrid
FamilyGH17
Protein PropertiesLength: 381 Molecular Weight: 42476.9 Isoelectric Point: 9.0117
ChromosomeChromosome/Scaffold: 4 Start: 17258416 End: 17259803
DescriptionO-Glycosyl hydrolases family 17 protein
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH17243530
  IGINYGQIGNNLPSPNRSVELIKSMKIGRVKLYDANPEILRLLSGTNISVSIMVPNNEITGIASDQSKADEWIRNNVLPYYPETMIRYLLVGNEILSYFS
  DQDRRLWHDVVPAMTKIKHSLRAKNITNIKIGTPLAMDVLQTSFPPSSGAFRSDVSETVIVPLLRFLNRTKSFFFIDVYPFFPWSSNPKEISLDFALLKN
  ISNNSSLLYTDPGSGLVYTNLLDQMLDSLIFAMTKLGYPHIRLLIAETGWPNSGGEQNQPGANVQNAATYNRNLVQKIVTKPTIGTPARPGVVIPTFIFS
  LYDENQKGGPGTERHWGLLYADGNPVYDID
Full Sequence
Protein Sequence     Length: 381     Download
MAPLAFLLLF PLVCLSAAEI SSKIGINYGQ IGNNLPSPNR SVELIKSMKI GRVKLYDANP    60
EILRLLSGTN ISVSIMVPNN EITGIASDQS KADEWIRNNV LPYYPETMIR YLLVGNEILS    120
YFSDQDRRLW HDVVPAMTKI KHSLRAKNIT NIKIGTPLAM DVLQTSFPPS SGAFRSDVSE    180
TVIVPLLRFL NRTKSFFFID VYPFFPWSSN PKEISLDFAL LKNISNNSSL LYTDPGSGLV    240
YTNLLDQMLD SLIFAMTKLG YPHIRLLIAE TGWPNSGGEQ NQPGANVQNA ATYNRNLVQK    300
IVTKPTIGTP ARPGVVIPTF IFSLYDENQK GGPGTERHWG LLYADGNPVY DIDLTGKRPV    360
NDYKPLPEKG HFIKRIHYDD *                                              420
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG5309COG53095.0e-526634582+
pfam00332Glyco_hydro_171.0e-11124353331+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2cyg_A0243541312A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
PDB1ghs_B0243541306A Chain A, The Three-Dimensional Structures Of Two Plant Beta-Glucan Endohydrolases With Distinct Substrate Specificities
PDB1ghs_A0243541306A Chain A, The Three-Dimensional Structures Of Two Plant Beta-Glucan Endohydrolases With Distinct Substrate Specificities
PDB3f55_D0233551316A Chain A, The Three-Dimensional Structures Of Two Plant Beta-Glucan Endohydrolases With Distinct Substrate Specificities
PDB3f55_C0233551316A Chain A, The Three-Dimensional Structures Of Two Plant Beta-Glucan Endohydrolases With Distinct Substrate Specificities
Signal Peptide
Cleavage Site
17
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_034_00089.1.45.369Aquca_009_00879.1.26.349
Arabidopsis lyrata493503.42.363479892.37.361317589.25.345
Arabidopsis thalianaAT4G14080.1.42.363AT3G23770.1.37.361AT3G07320.1.26.346
Brachypodium distachyonBradi4g34390.1.35.358Bradi3g40907.1.44.364Bradi5g12137.1.31.354
Brassica rapaBra001918.41.365Bra028343.37.360Bra029639.25.345Bra014979.39.363Bra001245.25.345
Bra032758.43.365Bra037057.43.364Bra038969.43.364
Carica papayaevm.model.supercontig_157.32.29.353evm.model.supercontig_8.110.24.345
Capsella rubellaCarubv10015952m.37.361Carubv10006945m.42.363Carubv10013655m.25.345
Citrus clementinaCiclev10004917m.28.352Ciclev10031440m.27.350
Citrus sinensisorange1.1g012660m.28.352orange1.1g038099m
Cucumis sativusCucsa.251950.1.28.351Cucsa.149990.1.26.347
Eucalyptus grandisEucgr.K02113.2.27.350Eucgr.K02113.1.27.350Eucgr.K02112.1
Fragaria vescamrna17437.1-v1.0-hybrid.135.456mrna17436.1-v1.0-hybrid.101.320mrna17436.1-v1.0-hybrid.101.320
Glycine maxGlyma13g24190.1Glyma08g46110.1.30.351Glyma18g32840.1.30.351
Gossypium raimondiiGorai.001G230200.2.24.345Gorai.001G230200.1.24.345Gorai.005G026800.1.26.346Gorai.N004800.1.27.348Gorai.006G224700.1.23.346
Linum usitatissimumLus10038211.25.346Lus10008881.29.352Lus10025892.18.281
Malus domesticaMDP0000317729.26.347MDP0000235663.26.347MDP0000283768.23.310
Manihot esculentacassava4.1_024973m.11.334cassava4.1_007070m.27.348cassava4.1_023781m.26.347
Medicago truncatulaMedtr8g012400.1.30.350
Mimulus guttatusmgv1a005896m.30.346mgv1a006049m.29.349mgv1a006924mmgv1a005774m.34.356
Oryza sativaLOC_Os08g41410.1.33.357LOC_Os09g32550.2.31.357LOC_Os09g32550.1.34.360LOC_Os03g62860.1.27.354
Panicum virgatumPavirv00008164m.48.370Pavirv00066351m.38.362Pavirv00059046m.35.359Pavirv00006057m.24.347Pavirv00044843m.143.335
Pavirv00044843m.143.335
Physcomitrella patensPp1s280_49V6.1Pp1s284_2V6.1Pp1s270_88V6.4.56.376Pp1s270_88V6.3.76.396Pp1s270_88V6.2.76.396
Pp1s270_88V6.1.56.376Pp1s218_3V6.2.53.373Pp1s218_3V6.1.53.373Pp1s70_290V6.1Pp1s268_55V6.2
Pp1s40_200V6.1Pp1s190_47V6.1Pp1s268_55V6.1Pp1s7_53V6.2Pp1s7_53V6.1
Pp1s145_119V6.1Pp1s197_147V6.1Pp1s312_32V6.1.39.359Pp1s53_51V6.2Pp1s53_51V6.1
Pp1s26_167V6.1
Phaseolus vulgarisPhvul.003G073900.1Phvul.010G023800.1.27.348Phvul.008G142200.1.29.349
Picea abiesMA_17470g0010.39.361MA_7353g0010.32.349MA_90526g0010.38.336
Populus trichocarpaPotri.017G060300.1.27.350Potri.002G247900.2.27.348Potri.002G247900.1.27.348Potri.002G247800.1.27.348
Ricinus communis30157.m000802
Setaria italicaSi015679m.50.372Si029669m.38.362
Selaginella moellendorffii156981437767.30.349230318413735.93.40982448
66564
Sorghum bicolorSb07g026540.1.48.370Sb02g029080.1.37.361Sb01g001430.1.38.362
Thellungiella halophilaThhalv10025081m.43.364Thhalv10002513m.35.359Thhalv10020663m.34.354Thhalv10020660m.34.354
Vitis viniferaGSVIVT01031698001.29.351GSVIVT01031619001.25.211
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)