y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna07651.1-v1.0-hybrid
FamilyGH35
Protein PropertiesLength: 868 Molecular Weight: 96472.3 Isoelectric Point: 8.1311
ChromosomeChromosome/Scaffold: Start: 8084305 End: 8088708
Descriptionglycosyl hydrolase family 35 protein
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH35793820
  IINGKHQLLFSGSIHYPRSPVEMWPDILRKARRGGLNVIQTYVFWNIHEPEKGQWNFEGNYDLVKFIRMIQDNGMYATLRVGPFIQAEWNHGGLPYWLRE
  VPDVIFRSDNAPYKKHMEEYVTKIMKLMKDNKLFSPQGGPIILAQIENEYNAIQLAYRELGDSYVQWAANLAVGQNIGVPWVMCKQVDAPDPVINTCNGR
  HCGDTFVGPNKPNKPALWTENWTAQYRVFGDPPSQRPAEDIAFSVARFFSKGGSLTNYYMYHGGTNFGRTSAVFTTTRYYDEAPLDEYAFQREPKWSHLK
  DLHK
Full Sequence
Protein Sequence     Length: 868     Download
MVVPSQRVLL ISFLLLLVST TLVHAKGNKP KAQGGGGGSL NGDDAAAGDN VDETDDPATQ    60
GGKKQLDHGP VTYDARSVII NGKHQLLFSG SIHYPRSPVE MWPDILRKAR RGGLNVIQTY    120
VFWNIHEPEK GQWNFEGNYD LVKFIRMIQD NGMYATLRVG PFIQAEWNHG GLPYWLREVP    180
DVIFRSDNAP YKKHMEEYVT KIMKLMKDNK LFSPQGGPII LAQIENEYNA IQLAYRELGD    240
SYVQWAANLA VGQNIGVPWV MCKQVDAPDP VINTCNGRHC GDTFVGPNKP NKPALWTENW    300
TAQYRVFGDP PSQRPAEDIA FSVARFFSKG GSLTNYYMYH GGTNFGRTSA VFTTTRYYDE    360
APLDEYAFQR EPKWSHLKDL HKSINLCKKT LLTGIPGTQR LGPDTEVRFY EKPGTECAAF    420
IANNHTTLEA TVNWRGQNYL LPPFSISVLP DCKTVVFNTQ QIVSQHNARN FVTSAKQMNW    480
EMYLEPVATV EQVPVNNREL QELYGLLKDK TDYAWYTTSI ELGPYDLPMK DTISPVVRIP    540
SLGHAMLVFV NDEYAGSQHG THAEKGFVFE APVKMKKGTN HISLLCMTVG LPDSGAYMEH    600
RYAGPRSVTI LGLNTGTIDV SANGWGHRAG LNGEKLQVFT EQGAQKVQWT KATGIGRALT    660
WYKTTFDAPP GGDPCAIRMT GMGKGMIWVN GISIGRHWMS FLSPLGQPTQ TEYHIPRAFI    720
KPKNLLVVLE EEPSDPKDIE IVTVNRDTIC SLIGQDYPGH VKYWDRKAGI LQHAPGKSLQ    780
ATALLNCPDY KKISKIEFAS YGNPDGSCGA LTMGTCNAPE SKKVVEDLCL GKMICTVPLD    840
PKLFFKAGDP CPGTKKKLMI QALCSFK*                                       900
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam02449Glyco_hydro_422.0e-898228149+
COG1874LacA7.0e-2171228167+
pfam02140Gal_Lectin5.0e-2178586483+
pfam01301Glyco_hydro_351.0e-14977384322+
PLN03059PLN03059071865821+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0004565beta-galactosidase activity
GO:0005529Interacting selectively and non-covalently with any carbohydrate, which includes monosaccharides, oligosaccharides and polysaccharides as well as substances derived from monosaccharides by reduction of the carbonyl group (alditols), by oxidation of one or more hydroxy groups to afford the corresponding aldehydes, ketones, or carboxylic acids, or by replacement of one or more hydroxy group(s) by a hydrogen atom. Cyclitols are generally not regarded as carbohydrates." [CHEBI:16646, GOC:mah]
GO:0005975carbohydrate metabolic process
GO:0009341beta-galactosidase complex
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3d3a_A8.00001e-41663803325A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
PDB3thd_D7e-397136511316A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
PDB3thd_D0.0007609758487630A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
PDB3thd_C7e-397136511316A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
Signal Peptide
Cleavage Site
25
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_014_00260.2Aquca_014_00260.1Aquca_006_00263.3Aquca_006_00263.2Aquca_006_00263.1
Arabidopsis lyrata496568476906491156480556912308
Arabidopsis thalianaAT5G63800.1AT1G77410.1AT4G38590.2AT4G38590.1AT2G16730.1
AT4G35010.1
Brachypodium distachyonBradi2g56597.1Bradi3g42330.1Bradi4g36517.1Bradi2g24670.1
Brassica rapaBra029200Bra011577Bra017687Bra013052Bra001991
Bra033571Bra024237
Carica papayaevm.model.supercontig_37.29evm.model.supercontig_64.121evm.model.supercontig_64.120evm.model.supercontig_37.144
Capsella rubellaCarubv10028665mCarubv10022317mCarubv10007813mCarubv10006573mCarubv10016129m
Citrus clementinaCiclev10000420mCiclev10004034mCiclev10003478mCiclev10023501mCiclev10026929m
Ciclev10030124m
Citrus sinensisorange1.1g003612morange1.1g041957morange1.1g045037morange1.1g035496morange1.1g006326m
orange1.1g006301m
Cucumis sativusCucsa.060550.1Cucsa.370570.1
Eucalyptus grandisEucgr.H05090.1Eucgr.G01775.1Eucgr.I02332.1Eucgr.I01412.1
Fragaria vescamrna24180.1-v1.0-hybridmrna11229.1-v1.0-hybridmrna06055.1-v1.0-hybrid
Glycine maxGlyma06g16430.1Glyma04g38580.3Glyma08g00470.1Glyma04g38580.1Glyma04g38580.2
Glyma08g00470.2Glyma04g42620.3Glyma06g12150.1Glyma04g42620.2Glyma06g12150.2
Glyma12g03650.1Glyma12g03650.2Glyma04g00520.1Glyma11g11500.1
Gossypium raimondiiGorai.012G037700.1Gorai.010G052200.1Gorai.010G052300.1Gorai.009G265200.1Gorai.002G197200.3
Gorai.002G197200.2Gorai.002G197200.1Gorai.002G197100.1Gorai.008G036000.1
Linum usitatissimumLus10020875.306.587Lus10020875.306.587Lus10028538Lus10033502Lus10033427
Lus10018138Lus10008259Lus10033500Lus10020875.38.306Lus10020875.38.306
Lus10014126Lus10019784Lus10005071Lus10027844Lus10027843
Malus domesticaMDP0000202466MDP0000316304MDP0000243780MDP0000206284MDP0000322037
MDP0000320504MDP0000225967MDP0000222132MDP0000863563
Manihot esculentacassava4.1_033913mcassava4.1_025630mcassava4.1_023088mcassava4.1_031197mcassava4.1_023181m
cassava4.1_023219m
Medicago truncatulaMedtr3g096910.1Medtr8g095690.1Medtr3g088520.1Medtr3g117840.1Medtr4g073290.1
Mimulus guttatusmgv1a018569mmgv1a001345m
Oryza sativaLOC_Os05g35360.1LOC_Os08g43570.1LOC_Os09g36810.1
Panicum virgatumPavirv00062685mPavirv00037142mPavirv00063105mPavirv00038064mPavirv00037143m
Pavirv00021342mPavirv00010263mPavirv00038026mPavirv00010484m
Phaseolus vulgarisPhvul.009G153000.1Phvul.009G127500.1Phvul.009G119400.1Phvul.L007600.1Phvul.009G119600.1
Phvul.011G035300.1
Picea abiesMA_65469g0020
Populus trichocarpaPotri.005G069200.2Potri.005G069200.1Potri.005G180600.1Potri.002G080700.1Potri.013G105100.1
Potri.009G134400.1Potri.004G174800.1
Prunus persicappa001308mppa019277mppa026900mppa020492m
Ricinus communis29648.m00200830074.m001370
Setaria italicaSi004751mSi021244mSi024535mSi013260mSi028962m
Sorghum bicolorSb09g021140.1Sb07g024870.1Sb02g031260.1
Thellungiella halophilaThhalv10018129mThhalv10005464mThhalv10024392mThhalv10022550m
Vitis viniferaGSVIVT01022353001GSVIVT01008835001GSVIVT01008834001GSVIVT01024031001
Zea maysAC234152.1_FGT005
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)