y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna07799.1-v1.0-hybrid
FamilyGT10
Protein PropertiesLength: 414 Molecular Weight: 45990.4 Isoelectric Point: 8.1293
ChromosomeChromosome/Scaffold: 5 Start: 17030776 End: 17037530
Descriptionfucosyltransferase 13
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT10994070
  QPSECGKKKKTQMEHVSVLVKGWTWIPDNLDNLYSCSCGLSCLWTKSAVLADKPDALLFETTTPPSQRLPGDPLRVYMDLEAGRKRSGVEDLYISYHAKD
  DVQATYAGALFHNGRNYHVSSSKNNDTLIYWSSSRCLPQRNKLAKRLLTLLPHHSFGKCLNNVGGLDMALSFYPECANGAGDGPQKWWDHLHCAMSHYKF
  VLAIENMMTESYVTEKLFYALDSGAVPIYFGAPNVWDFVPPHSIIDGSKFSNLEELASFVKALANDPVAYAEYHAWRRCGVLGNYVKTRALSLDTLPCRL
  CEAVGRKGG
Full Sequence
Protein Sequence     Length: 414     Download
MPLKPLNSFS IAFMLGGAFL LLFLCSFLEF PSLSTSQQPP IDDHHHHPSL SLTNSAPDPF    60
TNLISSFRKW DSLVGCPRFA EKHKSLTQNG SSSSSSLQQP SECGKKKKTQ MEHVSVLVKG    120
WTWIPDNLDN LYSCSCGLSC LWTKSAVLAD KPDALLFETT TPPSQRLPGD PLRVYMDLEA    180
GRKRSGVEDL YISYHAKDDV QATYAGALFH NGRNYHVSSS KNNDTLIYWS SSRCLPQRNK    240
LAKRLLTLLP HHSFGKCLNN VGGLDMALSF YPECANGAGD GPQKWWDHLH CAMSHYKFVL    300
AIENMMTESY VTEKLFYALD SGAVPIYFGA PNVWDFVPPH SIIDGSKFSN LEELASFVKA    360
LANDPVAYAE YHAWRRCGVL GNYVKTRALS LDTLPCRLCE AVGRKGGRYA KGY*          420
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam00852Glyco_transf_105.0e-29121400306+
Gene Ontology
GO TermDescription
GO:0006486protein glycosylation
GO:0008417fucosyltransferase activity
GO:0016020membrane
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2nzy_C0.0000005293370229306A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants
PDB2nzy_B0.0000005293370229306A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants
PDB2nzy_A0.0000005293370229306A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants
PDB2nzx_C0.0000005293370229306A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants
PDB2nzx_B0.0000005293370229306A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants
Transmembrane Domains
StartEnd
931
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_014_00169.1Aquca_014_00169.2
Arabidopsis lyrata895045
Arabidopsis thalianaAT1G71990.1
Brachypodium distachyonBradi4g41520.1
Brassica rapaBra016092
Carica papayaevm.model.supercontig_66.28
Capsella rubellaCarubv10020397mCarubv10020716m
Citrus clementinaCiclev10001278m
Citrus sinensisorange1.1g014584m
Cucumis sativusCucsa.364200.1
Eucalyptus grandisEucgr.F02589.1Eucgr.F02598.1
Glycine maxGlyma10g36190.1Glyma16g27090.1Glyma02g08070.1Glyma20g31430.1
Gossypium raimondiiGorai.013G139900.1Gorai.013G139900.2Gorai.013G139900.3
Linum usitatissimumLus10009440Lus10006076
Malus domesticaMDP0000523653MDP0000409821MDP0000236359
Manihot esculentacassava4.1_008756m
Mimulus guttatusmgv1a007330mmgv1a007293m
Oryza sativaLOC_Os12g07290.1LOC_Os04g35270.1
Panicum virgatumPavirv00060280mPavirv00060279mPavirv00014444m
Physcomitrella patensPp1s151_12V6.1
Phaseolus vulgarisPhvul.007G088300.1
Picea abiesMA_10427853g0010
Populus trichocarpaPotri.013G111200.1Potri.019G082200.1
Prunus persicappa006380m
Ricinus communis29728.m000796
Setaria italicaSi010181m
Selaginella moellendorffii96619
Sorghum bicolorSb08g004540.1
Thellungiella halophilaThhalv10027318mThhalv10018642m
Vitis viniferaGSVIVT01034778001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny