y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna07968.1-v1.0-hybrid
FamilyGT35
Protein PropertiesLength: 836 Molecular Weight: 94929.2 Isoelectric Point: 7.7958
ChromosomeChromosome/Scaffold: 3 Start: 22122159 End: 22127002
Descriptionalpha-glucan phosphorylase 2
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT351098300
  ALNKLGHDLENITEQEKDAALGNGGLGRLASCFLDSMATLNLPAWGYGLRYRYGLFKQRIAKDGQEETAEDWLEKFSPWEVVRHDVVYPVRFFGRVHVNP
  DGSRKWVEGEVLRALAYDVPIPGYKTKNTISLRLWDAKACSEDFNLFQFNDGQYESAAQLHSRAQQICAVLYPGDATEEGKLLRLKQQFFLCSASLQDII
  FRFKERKQGAELKWSEFPTKVAVQMNDTHPTLAIPELMRLLLDEEGLGWDEAWDVTSRTVAYTNHTVLPEALEKWSQTVMWKLLPRHMEIIQEIDKRFIE
  MVRATRKDLQNKIPTMCVLDNNPQKPVVRMANLCVVSAHTVNGVAELHSDILKNELFADYVSIWPSKFQNKTNGITPRRWLKFCSPELSNIITKWLKTDE
  WATNLDLLVGLRKLADDAKLQEEWASAKMANKKRLAQYIEHVTGVEIDPNSLFDIQVKRIHEYKRQLLNILGAIYRYKKLKEMSPEERKKATPRTVMIGG
  KAFATYTNAKRIVKLVNDVGDVVNTDPEVNSYLKVVFVPNYNVSVAELLIPGSELSQHISTAGMEASGTSNMKFALNGCLIIGTLDGANVEIREEVGQAN
  FFLFGATADEVPKLRKDRENGLFKPDPRFEEAKKFIRSGAFGSYDYNPLLDSLEGNSGFGRADYFLVGHDFAGYLDAQARVDEAYKDKKKWLKSSILSTA
  GSGKFSSDRTIAQYAKEIWKIE
Full Sequence
Protein Sequence     Length: 836     Download
MAKPNREASK IPAAANPLAE EPTKIASNIN YHANFSPHFS PFKFESEQAY YATAESVRDR    60
LIQNWNETYV HFHRKNPKQT YYLSMEYLQG RALTNAIGNL NVQGAYAEAL NKLGHDLENI    120
TEQEKDAALG NGGLGRLASC FLDSMATLNL PAWGYGLRYR YGLFKQRIAK DGQEETAEDW    180
LEKFSPWEVV RHDVVYPVRF FGRVHVNPDG SRKWVEGEVL RALAYDVPIP GYKTKNTISL    240
RLWDAKACSE DFNLFQFNDG QYESAAQLHS RAQQICAVLY PGDATEEGKL LRLKQQFFLC    300
SASLQDIIFR FKERKQGAEL KWSEFPTKVA VQMNDTHPTL AIPELMRLLL DEEGLGWDEA    360
WDVTSRTVAY TNHTVLPEAL EKWSQTVMWK LLPRHMEIIQ EIDKRFIEMV RATRKDLQNK    420
IPTMCVLDNN PQKPVVRMAN LCVVSAHTVN GVAELHSDIL KNELFADYVS IWPSKFQNKT    480
NGITPRRWLK FCSPELSNII TKWLKTDEWA TNLDLLVGLR KLADDAKLQE EWASAKMANK    540
KRLAQYIEHV TGVEIDPNSL FDIQVKRIHE YKRQLLNILG AIYRYKKLKE MSPEERKKAT    600
PRTVMIGGKA FATYTNAKRI VKLVNDVGDV VNTDPEVNSY LKVVFVPNYN VSVAELLIPG    660
SELSQHISTA GMEASGTSNM KFALNGCLII GTLDGANVEI REEVGQANFF LFGATADEVP    720
KLRKDRENGL FKPDPRFEEA KKFIRSGAFG SYDYNPLLDS LEGNSGFGRA DYFLVGHDFA    780
GYLDAQARVD EAYKDKKKWL KSSILSTAGS GKFSSDRTIA QYAKEIWKIE ECRVP*        840
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd04300GT1_Glycogen_Phosphorylase026829813+
TIGR02093P_ylase029829809+
pfam00343Phosphorylase0109831728+
PRK14985PRK14985082828752+
COG0058GlgP047830789+
Gene Ontology
GO TermDescription
GO:0004645phosphorylase activity
GO:0005975carbohydrate metabolic process
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1z8d_A01983322832A Chain A, Crystal Structure Of Human Muscle Glycogen Phosphorylase A With Amp And Glucose
PDB2gj4_A01983310820A Chain A, Structure Of Rabbit Muscle Glycogen Phosphorylase In Complex With Ligand
PDB4el5_A01983310820A Chain A, Structure Of Rabbit Muscle Glycogen Phosphorylase In Complex With Ligand
PDB4el0_A01983310820A Chain A, Structure Of Rabbit Muscle Glycogen Phosphorylase In Complex With Ligand
PDB4eky_A01983310820A Chain A, Structure Of Rabbit Muscle Glycogen Phosphorylase In Complex With Ligand
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_009_00755.3Aquca_009_00755.2Aquca_009_00755.1Aquca_002_00786.1Aquca_002_00786.2
Arabidopsis lyrata485074323006
Arabidopsis thalianaAT3G46970.1AT3G29320.1
Brachypodium distachyonBradi2g55120.1Bradi1g08070.1.569.972Bradi1g08070.1.569.972Bradi1g08070.1.163.525Bradi1g08070.1.163.525
Brassica rapaBra018180Bra025392Bra033098
Carica papayaevm.model.supercontig_27.5evm.model.supercontig_112.64.358.739evm.model.supercontig_112.64.358.739evm.model.supercontig_14.158evm.model.supercontig_112.64.117.357
evm.model.supercontig_112.64.117.357
Capsella rubellaCarubv10019408mCarubv10016634m
Chlamydomonas reinhardtiiCre12.g552200.t1.2Cre07.g336950.t1.1
Citrus clementinaCiclev10027815mCiclev10027813mCiclev10010975m.585.995Ciclev10010975m.585.995Ciclev10010975m.176.514
Ciclev10010975m.176.514
Citrus sinensisorange1.1g004485morange1.1g003202morange1.1g003197morange1.1g003196morange1.1g003188m
orange1.1g003186morange1.1g005595morange1.1g003693morange1.1g003742morange1.1g004697m
orange1.1g004696morange1.1g007597morange1.1g003875m.374.784orange1.1g003875m.374.784orange1.1g003079m.434.844
orange1.1g003079m.434.844orange1.1g003074m.434.844orange1.1g003074m.434.844orange1.1g003072m.434.844orange1.1g003072m.434.844
orange1.1g003055m.436.846orange1.1g003055m.436.846orange1.1g001879m.585.995orange1.1g001879m.585.995orange1.1g009651m
orange1.1g002111morange1.1g012447morange1.1g005402m.400.692orange1.1g005402m.400.692orange1.1g005402m.25.349
orange1.1g005402m.25.349orange1.1g003079m.25.349orange1.1g003079m.25.349orange1.1g003074m.25.349orange1.1g003074m.25.349
orange1.1g003072m.25.349orange1.1g003072m.25.349orange1.1g001879m.176.500orange1.1g001879m.176.500orange1.1g003055m.25.351
orange1.1g003055m.25.351orange1.1g026345m
Cucumis sativusCucsa.126920.10Cucsa.126920.1Cucsa.139040.4Cucsa.139040.3Cucsa.139040.2
Cucsa.139040.1Cucsa.284600.1Cucsa.273090.1
Eucalyptus grandisEucgr.B02278.2Eucgr.B02278.1Eucgr.B03166.3Eucgr.B03166.2Eucgr.J01374.1
Eucgr.B03166.1Eucgr.B03166.5Eucgr.B03166.4
Fragaria vescamrna29749.1-v1.0-hybridmrna04322.1-v1.0-hybrid.157.481mrna04322.1-v1.0-hybrid.157.481
Glycine maxGlyma13g30920.2Glyma13g30920.3Glyma08g45210.1Glyma18g07480.1Glyma20g03250.4.554.965
Glyma20g03250.4.554.965Glyma20g03250.3.562.973Glyma20g03250.3.562.973Glyma20g03250.2.562.973Glyma20g03250.2.562.973
Glyma13g06040.1Glyma19g03490.1Glyma20g03250.4.161.485Glyma20g03250.4.161.485Glyma20g03250.3.169.493
Glyma20g03250.3.169.493Glyma20g03250.2.169.493Glyma20g03250.2.169.493
Gossypium raimondiiGorai.009G166800.1Gorai.013G260900.2Gorai.013G260900.1Gorai.013G260900.3Gorai.006G011500.7.330.728
Gorai.006G011500.7.330.728Gorai.006G011500.4.514.912Gorai.006G011500.4.514.912Gorai.006G011500.3.580.978Gorai.006G011500.3.580.978
Gorai.006G011500.2.583.981Gorai.006G011500.2.583.981Gorai.006G011500.1.583.986Gorai.006G011500.1.583.986Gorai.013G092200.1
Gorai.013G092200.2Gorai.006G011500.6.177.501Gorai.006G011500.6.177.501Gorai.006G011500.5.180.504Gorai.006G011500.5.180.504
Gorai.006G011500.4.111.435Gorai.006G011500.4.111.435Gorai.006G011500.3.177.501Gorai.006G011500.3.177.501Gorai.006G011500.2.180.504
Gorai.006G011500.2.180.504Gorai.006G011500.1.180.504Gorai.006G011500.1.180.504Gorai.006G011500.6.580.815Gorai.006G011500.6.580.815
Gorai.006G011500.5.583.818Gorai.006G011500.5.583.818
Linum usitatissimumLus10036892Lus10042688Lus10037093Lus10029643Lus10029644
Malus domesticaMDP0000288190MDP0000123354MDP0000266061MDP0000129346.602.999MDP0000129346.602.999
MDP0000145828MDP0000128518MDP0000778598MDP0000259799MDP0000129346.170.509
MDP0000129346.170.509MDP0000211642
Manihot esculentacassava4.1_001626mcassava4.1_002082mcassava4.1_024481mcassava4.1_002466mcassava4.1_002614m.310.707
cassava4.1_002614m.310.707cassava4.1_001096mcassava4.1_025456mcassava4.1_007176mcassava4.1_004717m.211.560
cassava4.1_004717m.211.560cassava4.1_002614m.25.217cassava4.1_002614m.25.217cassava4.1_004717m.25.195cassava4.1_004717m.25.195
cassava4.1_009211m
Medicago truncatulaMedtr2g014460.1Medtr6g014480.1Medtr4g082950.1.578.876Medtr4g082950.1.578.876Medtr4g082950.1.170.494
Medtr4g082950.1.170.494Medtr6g014480.2
Mimulus guttatusmgv1a000698mmgv1a001277mmgv1a000878mmgv1a002586mmgv1a002585m
Oryza sativaLOC_Os01g63270.1LOC_Os01g63270.2LOC_Os03g55090.1
Panicum virgatumPavirv00009874mPavirv00050649mPavirv00050650mPavirv00004990m.515.914Pavirv00004990m.515.914
Pavirv00034922m.529.918Pavirv00034922m.529.918Pavirv00034922m.119.465Pavirv00034922m.119.465Pavirv00004990m.97.438
Pavirv00004990m.97.438
Physcomitrella patensPp1s30_182V6.1Pp1s180_124V6.1Pp1s86_213V6.1Pp1s195_41V6.1Pp1s53_212V6.1.566.981
Pp1s53_212V6.1.566.981Pp1s53_212V6.1.179.499Pp1s53_212V6.1.179.499
Phaseolus vulgarisPhvul.006G182300.1Phvul.006G064100.1Phvul.002G168400.1.570.971Phvul.002G168400.1.570.971Phvul.004G034400.1.582.980
Phvul.004G034400.1.582.980Phvul.002G168400.1.169.519Phvul.002G168400.1.169.519Phvul.004G034400.1.180.504Phvul.004G034400.1.180.504
Picea abiesMA_10437129g0010MA_14581g0010MA_10428980g0010
Populus trichocarpaPotri.004G048600.1Potri.004G048600.2Potri.009G041800.1Potri.009G041800.3Potri.010G160200.2
Potri.009G041800.4Potri.009G041800.2.126.655Potri.009G041800.2.126.655Potri.004G123600.5Potri.010G160200.5
Potri.010G160200.1Potri.010G160200.7Potri.010G160200.4Potri.010G160200.3Potri.004G123600.4.176.534
Potri.004G123600.4.176.534Potri.004G123600.3.176.534Potri.004G123600.3.176.534Potri.004G123600.2.176.534Potri.004G123600.2.176.534
Potri.004G123600.1.176.533Potri.004G123600.1.176.533Potri.010G160200.6Potri.009G041800.2.660.825Potri.009G041800.2.660.825
Prunus persicappa000587mppa001354mppa000958mppa000827m.586.983ppa000827m.586.983
ppa000827m.171.506ppa000827m.171.506
Ricinus communis29751.m00179630190.m011310.461.94330190.m011310.461.94330174.m00913629630.m000793
30190.m011310.264.44430190.m011310.264.444
Setaria italicaSi000306mSi034019m
Selaginella moellendorffii148158164611184206
Sorghum bicolorSb03g040060.1Sb01g007560.2.550.949Sb01g007560.2.550.949Sb01g007560.1.580.979Sb01g007560.1.580.979
Sb01g007560.2.140.492Sb01g007560.2.140.492Sb01g007560.1.170.522Sb01g007560.1.170.522
Thellungiella halophilaThhalv10010122mThhalv10003599m
Vitis viniferaGSVIVT01021111001GSVIVT01024804001GSVIVT01012194001GSVIVT01011504001.577.977GSVIVT01011504001.577.977
GSVIVT01011504001.177.501GSVIVT01011504001.177.501
Volvox carteriVocar20006426mVocar20001423m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)