y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna08285.1-v1.0-hybrid
FamilyAA3
Protein PropertiesLength: 552 Molecular Weight: 60506.7 Isoelectric Point: 8.1737
ChromosomeChromosome/Scaffold: 2 Start: 13189848 End: 13193322
DescriptionLong-chain fatty alcohol dehydrogenase family protein
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA31865476.4e-25
  SIYVPRNSSADHYCGSCNYGCPTGDKQGTDSTWLVDAVKCGAVILTGCKAERFIMENDHQGGTSRKRCLGVQAISLCKNITKKLQIEAKVTISACGSLLT
  PPLMITSGLKNPNIGRNLHLHPVLLAWGYFPEDSSEFKGKTFEGGIITSLHKVVSENNQNVRAIVETPAIGPASFATLVPWVSGLDMKDRMAKYARTAHL
  FALVRDKGSGEVRAENKIEYRLDRSDKENIQAGLRQAVRILIAAGAVEVGTYRNDGQRIVCKGTKKEDLEEFLDSVIAVGGPSTRGEHWTMYSSAHQMGS
  CKMGATEKEGGVDENGESWEAKGLFVCDGSLLPTAVGVNPMITIQSTAYCLSKKIADSLKKR
Full Sequence
Protein Sequence     Length: 552     Download
MEERENSHHP LLSGVRSSKF SHGFSAAQIQ SLAAMCEALI PPLSLDDTSD QALHSFYKAS    60
GSEPPIPDEV ADLIKKRGVP EAVGLLSFFL KVLSYRLGTL LVCGYPCLDR KGPFIHNFAE    120
MSLEKREEAL QRWSREKRLI PLRLLFVVVK IFCFFCFFSR VSKLDGVDEG ALLVRTLKLR    180
TCEDFSIYVP RNSSADHYCG SCNYGCPTGD KQGTDSTWLV DAVKCGAVIL TGCKAERFIM    240
ENDHQGGTSR KRCLGVQAIS LCKNITKKLQ IEAKVTISAC GSLLTPPLMI TSGLKNPNIG    300
RNLHLHPVLL AWGYFPEDSS EFKGKTFEGG IITSLHKVVS ENNQNVRAIV ETPAIGPASF    360
ATLVPWVSGL DMKDRMAKYA RTAHLFALVR DKGSGEVRAE NKIEYRLDRS DKENIQAGLR    420
QAVRILIAAG AVEVGTYRND GQRIVCKGTK KEDLEEFLDS VIAVGGPSTR GEHWTMYSSA    480
HQMGSCKMGA TEKEGGVDEN GESWEAKGLF VCDGSLLPTA VGVNPMITIQ STAYCLSKKI    540
ADSLKKRLVV D*                                                        600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
TIGR03970Rv06970.008394529139+
COG2303BetA9.0e-17197547388+
pfam05199GMC_oxred_C7.0e-20403536134+
pfam00732GMC_oxred_N8.0e-42189308122+
Gene Ontology
GO TermDescription
GO:0016614oxidoreductase activity, acting on CH-OH group of donors
GO:0050660flavin adenine dinucleotide binding
GO:0055114oxidation-reduction process
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3nne_H0.0000003228529225515A Chain A, Crystal Structure Of Choline Oxidase S101a Mutant
PDB3nne_G0.0000003228529225515A Chain A, Crystal Structure Of Choline Oxidase S101a Mutant
PDB3nne_F0.0000003228529225515A Chain A, Crystal Structure Of Choline Oxidase S101a Mutant
PDB3nne_E0.0000003228529225515A Chain A, Crystal Structure Of Choline Oxidase S101a Mutant
PDB3nne_D0.0000003228529225515A Chain A, Crystal Structure Of Choline Oxidase S101a Mutant
Transmembrane Domains
StartEnd
139161
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_089_00009.1Aquca_049_00132.1Aquca_034_00307.1Aquca_034_00304.1
Arabidopsis lyrata914728491906479855470376
Arabidopsis thalianaAT4G19380.1AT4G28570.1AT3G23410.1AT1G03990.1
Brachypodium distachyonBradi3g28677.1Bradi3g28657.1Bradi3g49085.1
Brassica rapaBra012548Bra024190Bra013391Bra015283Bra001912
Bra014947
Carica papayaevm.model.supercontig_165.33evm.model.supercontig_44.31evm.model.supercontig_2124.1
Capsella rubellaCarubv10004418mCarubv10004208mCarubv10012453mCarubv10004212mCarubv10013046m
Citrus clementinaCiclev10011111mCiclev10004403mCiclev10004405mCiclev10018992m
Citrus sinensisorange1.1g003990morange1.1g004496m
Cucumis sativusCucsa.037200.2Cucsa.037200.1Cucsa.035240.1Cucsa.255570.1
Eucalyptus grandisEucgr.H03017.2Eucgr.H03017.1Eucgr.H00753.1Eucgr.K02114.1Eucgr.D02566.1
Eucgr.D02568.1
Fragaria vescamrna08288.1-v1.0-hybridmrna11513.1-v1.0-hybrid
Glycine maxGlyma09g35210.2Glyma01g35620.1Glyma16g16415.1Glyma16g08300.2Glyma10g32640.2
Glyma12g15940.1Glyma19g34960.1Glyma06g42400.2Glyma03g32220.2
Gossypium raimondiiGorai.001G179800.3Gorai.001G179800.2Gorai.001G179800.1Gorai.011G177100.3Gorai.011G177100.2
Gorai.011G177100.1Gorai.006G252500.1
Linum usitatissimumLus10003621Lus10024922Lus10035673Lus10008239Lus10022903
Lus10037257Lus10011800
Malus domesticaMDP0000233110MDP0000173300MDP0000208936MDP0000197715
Manihot esculentacassava4.1_004067mcassava4.1_002349mcassava4.1_002619mcassava4.1_002379mcassava4.1_025870m
Medicago truncatulaMedtr5g025650.1Medtr8g072210.1Medtr4g081080.1Medtr1g075650.1Medtr4g080890.1
Mimulus guttatusmgv1a001761mmgv1a022390mmgv1a001868mmgv1a001883mmgv1a001896m
Oryza sativaLOC_Os10g33540.1LOC_Os10g33520.1LOC_Os10g33460.1LOC_Os02g40840.1
Panicum virgatumPavirv00054947m
Physcomitrella patensPp1s58_61V6.1Pp1s7_216V6.1Pp1s48_250V6.1Pp1s2_413V6.1
Phaseolus vulgarisPhvul.002G122600.1Phvul.003G278200.1Phvul.007G124200.1Phvul.001G162800.1Phvul.011G136600.1
Picea abiesMA_10427118g0010MA_9032943g0010MA_9483g0010MA_10427421g0010MA_242814g0010
Populus trichocarpaPotri.004G234900.2Potri.004G234900.1Potri.010G069100.1Potri.008G169300.1Potri.002G259700.1
Prunus persicappa014756mppa018458mppa021498m
Ricinus communis29827.m00265529981.m00058628492.m000467
Setaria italicaSi034362mSi034354mSi034359mSi016380m
Selaginella moellendorffii1140891168557460173531
Sorghum bicolorSb01g019470.1Sb01g019460.1Sb01g019480.1Sb04g026370.1Sb04g026390.1
Thellungiella halophilaThhalv10024717mThhalv10024496mThhalv10024528mThhalv10020141mThhalv10006882m
Vitis viniferaGSVIVT01036891001GSVIVT01027855001GSVIVT01028371001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)