y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna08735.1-v1.0-hybrid
FamilyGT2
Protein PropertiesLength: 696 Molecular Weight: 79377 Isoelectric Point: 9.2355
ChromosomeChromosome/Scaffold: 2 Start: 19959218 End: 19962208
DescriptionCellulose-synthase-like C5
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT22344101.1e-29
  VQIPMCNEKEVYEQSISAVCQIDWPKDRILIQVLDDSDDESIQWLIKSEVADWSQKGVNIIYRHREIRTGYKAGNLKSAMSCDYVKDYEFVAIFDADFQP
  NPDFLKRTVPHFKGNPEVGLVQARWAFVNKDENLLTRLQNINLCFHFEVEQQVNGVFLNFFGFNGTAGVWRIKALEE
Full Sequence
Protein Sequence     Length: 696     Download
MAPRLDFSKM WAKNAKKGGG TPVVVKMENP NFSVVEIDGP DSAFRPVEKS RGKNAKQASW    60
VLLLKAQRFV SLIASMATLL WSLLGTINKR LIFRQGVAME NGKLGKGRLL FTVIRVFLVS    120
SIAILVFEVV AYFKGWHYFR NPSLHIPRTS DIQGLLHMVY VAWLRFRADY IAPPIQALST    180
FCIVLFMIQS ADRMILSLGC LWIKYKKIKP TIDSNAMKSD DLEKSDYEYP MVLVQIPMCN    240
EKEVYEQSIS AVCQIDWPKD RILIQVLDDS DDESIQWLIK SEVADWSQKG VNIIYRHREI    300
RTGYKAGNLK SAMSCDYVKD YEFVAIFDAD FQPNPDFLKR TVPHFKGNPE VGLVQARWAF    360
VNKDENLLTR LQNINLCFHF EVEQQVNGVF LNFFGFNGTA GVWRIKALEE SGGWLERTTV    420
EDMDIAVRAH LNGWKFIYLN DVQVLCEVPE SYEAYRKQQH RWHSGPMQLF RLCLPAVITS    480
KVSAWKKANL ILLFFLLRKL ILPFYSFTLF CIILPLTMFV PEAELPSWVI CYVPVFMSLL    540
NVLPAPRSFP FIVPYLLFEN TMSVTKFNAM VSGLFQLGSS YEWIVTKKAG RSSESDLLAA    600
AERETKMINQ LPVHRGASES ELSELNKLME HKVVSPLPVK KANKIYRKEL ALAFLLLTAS    660
VRSLLAAQGV HFYFLLFQGV TFLLVGLDLI GEQIS*                              720
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd06435CESA_NdvC_like5.0e-32234471240+
cd06423CESA_like4.0e-32234422189+
COG1215COG12151.0e-37224472251+
cd06421CESA_CelA_like7.0e-55230470247+
cd06437CESA_CaSu_A25.0e-111230466237+
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB4hg6_A4e-25228475138396B Chain B, Structure Of A Cellulose Synthase - Cellulose Translocation Intermediate
Transmembrane Domains
StartEnd
6988
109131
166188
494516
536558
650672
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_004_00030.2Aquca_004_00030.1Aquca_058_00217.3Aquca_058_00217.2Aquca_058_00217.1
Aquca_002_00287.1Aquca_017_00107.1Aquca_083_00103.2Aquca_083_00103.1Aquca_019_00047.2
Aquca_019_00047.1Aquca_030_00077.1Aquca_009_00991.3Aquca_009_00991.2Aquca_009_00991.1
Aquca_019_00048.1Aquca_030_00077.2Aquca_009_00991.4
Arabidopsis lyrata491580901017484602478055489694
487155482526489123883535907034
889889915064488470313253874206
Arabidopsis thalianaAT4G31590.1AT2G24630.1AT3G28180.1AT3G07330.1AT4G07960.1
AT5G03760.1AT2G35650.1AT5G22740.1AT4G13410.1AT5G16190.1
AT1G23480.3AT1G23480.2AT1G23480.1AT3G56000.1AT1G24070.1
AT4G16590.1
Brachypodium distachyonBradi3g19087.1Bradi1g07277.1Bradi1g57552.1Bradi2g50967.1Bradi2g20141.2
Bradi2g20141.1Bradi3g59447.1Bradi3g36697.1Bradi1g20500.1Bradi4g38970.1
Bradi3g06740.2Bradi3g06740.1Bradi3g25658.1Bradi1g35647.1
Brassica rapaBra011284Bra007838Bra025323Bra039061Bra001246
Bra000635Bra023993Bra005779Bra009512Bra020212
Bra023020Bra002426Bra006633Bra012416Bra024603
Bra008638Bra012702Bra007207Bra006343Bra017305
Bra032705
Carica papayaevm.model.supercontig_23.38evm.model.supercontig_286.3evm.model.supercontig_160.31evm.model.supercontig_8.105evm.model.supercontig_5.88
evm.model.supercontig_720.2evm.model.supercontig_47.50
Capsella rubellaCarubv10004278mCarubv10022768mCarubv10016783mCarubv10013120mCarubv10000367m
Carubv10000681mCarubv10000683mCarubv10004510mCarubv10000762mCarubv10004546m
Carubv10008745mCarubv10025026mCarubv10008757mCarubv10019203m
Chlamydomonas reinhardtiig6025.t2g6025.t1
Citrus clementinaCiclev10007641mCiclev10014531mCiclev10030861mCiclev10000437mCiclev10013685m
Ciclev10031284mCiclev10011455mCiclev10028164m
Citrus sinensisorange1.1g005507morange1.1g006104morange1.1g041566morange1.1g011596morange1.1g005700m
orange1.1g009761morange1.1g044519morange1.1g041333m
Cucumis sativusCucsa.311130.1Cucsa.158900.1Cucsa.387710.1Cucsa.353070.1Cucsa.395390.1
Cucsa.163310.2Cucsa.163310.1Cucsa.385420.7Cucsa.385420.4Cucsa.385420.1
Cucsa.083070.1Cucsa.083080.1Cucsa.378620.1
Eucalyptus grandisEucgr.C02007.1Eucgr.I01833.1Eucgr.F02219.1Eucgr.F00101.1Eucgr.H00749.1
Eucgr.F04010.1Eucgr.G02715.1Eucgr.A01558.2Eucgr.A01558.1Eucgr.J00420.1
Eucgr.A01558.3
Fragaria vescamrna05685.1-v1.0-hybridmrna17431.1-v1.0-hybridmrna28359.1-v1.0-hybridmrna26403.1-v1.0-hybridmrna02631.1-v1.0-hybrid
mrna14456.1-v1.0-hybridmrna30129.1-v1.0-hybridmrna23579.1-v1.0-hybrid
Glycine maxGlyma08g23820.1Glyma04g08100.1Glyma14g18140.1Glyma07g00590.1Glyma06g08180.1
Glyma17g29060.1Glyma13g04480.1Glyma16g10680.1Glyma03g21730.1Glyma19g01560.1
Glyma14g10230.1Glyma06g05190.1Glyma04g05100.1Glyma19g37480.2Glyma19g37480.1
Glyma03g34800.1Glyma19g36810.1Glyma10g34550.1Glyma20g32990.1Glyma10g07560.1
Glyma13g21440.1Glyma03g34060.1Glyma17g05350.1Glyma11g19490.1Glyma12g08990.1
Glyma10g34550.2
Gossypium raimondiiGorai.001G040500.1Gorai.009G066500.1Gorai.010G120900.1Gorai.006G028400.1Gorai.N005100.8
Gorai.N005100.7Gorai.N005100.6Gorai.N005100.5Gorai.N005100.4Gorai.N005100.1
Gorai.005G098600.2Gorai.005G098600.1Gorai.010G028300.3Gorai.010G028300.2Gorai.010G028300.1
Gorai.009G222300.1Gorai.009G277600.1Gorai.006G028400.2Gorai.011G232100.1Gorai.002G243400.2
Gorai.002G243400.1Gorai.009G305600.1Gorai.006G109100.6Gorai.006G109100.4Gorai.006G109100.3
Gorai.006G109100.2Gorai.006G109100.1Gorai.004G008100.1Gorai.006G109100.7Gorai.006G109100.5
Gorai.004G008100.2
Linum usitatissimumLus10026923Lus10020120Lus10039440Lus10039475Lus10038217
Lus10025886Lus10007715Lus10018651Lus10008646Lus10035580
Lus10009387Lus10020539
Malus domesticaMDP0000270189MDP0000201865MDP0000174127MDP0000286908MDP0000295826
MDP0000183140MDP0000264823MDP0000300397MDP0000130989MDP0000572242
MDP0000215777MDP0000139721MDP0000297462MDP0000717000MDP0000263736
MDP0000233405MDP0000307919MDP0000133719MDP0000230967MDP0000210684
MDP0000712023
Manihot esculentacassava4.1_002818mcassava4.1_003168mcassava4.1_003164mcassava4.1_003038mcassava4.1_003026m
cassava4.1_002707mcassava4.1_002727mcassava4.1_005319mcassava4.1_025352mcassava4.1_005126m
cassava4.1_005132m
Medicago truncatulaMedtr3g109040.1Medtr4g006010.1Medtr8g012320.1Medtr1g061510.1Medtr4g055520.2
Medtr4g055520.1Medtr4g055520.3
Mimulus guttatusmgv1a004672mmgv1a002241mmgv1a003162mmgv1a002316mmgv1a002362m
mgv1a026509mmgv1a017694mmgv1a023425mmgv1a004346mmgv1a004073m
mgv1a004186mmgv1a004240mmgv1a004482m
Oryza sativaLOC_Os09g25900.1LOC_Os08g15420.1LOC_Os03g56060.1LOC_Os07g03260.1LOC_Os01g56130.1
LOC_Os05g43530.1LOC_Os06g42020.1LOC_Os02g51060.1LOC_Os07g43710.1LOC_Os03g26044.1
LOC_Os03g07350.1LOC_Os02g09930.2LOC_Os02g09930.1LOC_Os08g33740.1LOC_Os10g26630.1
LOC_Os06g12460.1LOC_Os09g26770.3LOC_Os09g26770.2
Panicum virgatumPavirv00057615mPavirv00060038mPavirv00017495mPavirv00029970mPavirv00058766m
Pavirv00058702mPavirv00035780mPavirv00052315mPavirv00014001mPavirv00046697m
Pavirv00037606mPavirv00039936mPavirv00009713mPavirv00050985mPavirv00050984m
Pavirv00049797mPavirv00049796mPavirv00022626mPavirv00054691mPavirv00036002m
Pavirv00060323mPavirv00013640mPavirv00029891mPavirv00059726mPavirv00017665m
Pavirv00001702mPavirv00036247mPavirv00035687m
Physcomitrella patensPp1s162_130V6.1Pp1s224_44V6.1Pp1s89_286V6.1Pp1s19_258V6.1Pp1s373_28V6.1
Pp1s164_5V6.1Pp1s15_115V6.1Pp1s65_194V6.1Pp1s36_214V6.1Pp1s36_62V6.1
Pp1s372_55V6.1
Phaseolus vulgarisPhvul.008G255800.1Phvul.009G102200.1Phvul.004G019600.1Phvul.010G024700.1Phvul.009G074400.1
Phvul.007G105400.1Phvul.001G185800.1Phvul.007G223800.1Phvul.011G089900.1
Picea abiesMA_10429365g0010MA_10431741g0020MA_712121g0010MA_96942g0010MA_159111g0350.427.597
Populus trichocarpaPotri.018G009300.1Potri.006G270900.1Potri.014G190900.1Potri.002G248400.2Potri.002G248400.1
Potri.005G146900.1Potri.002G114200.1Potri.008G026400.1Potri.006G116900.4Potri.006G116900.3
Potri.006G116900.2Potri.006G116900.1Potri.004G189000.1Potri.009G149700.5Potri.009G149700.3
Potri.009G149700.2Potri.009G149700.1Potri.010G234100.1Potri.006G116900.5Potri.009G149700.4
Prunus persicappa002254mppa002275mppa002511mppa002311mppa002209m
ppa024741mppa004315mppa004330mppa003918mppa004037m
Ricinus communis29848.m00447729822.m00338530170.m01366029991.m00063829092.m000444
29428.m000330
Setaria italicaSi013296mSi032804mSi000541mSi035399mSi034503m
Si021376mSi029148mSi016839mSi029676mSi006161m
Si016912mSi035101mSi034919mSi035204mSi032179m
Si008033mSi015800m
Selaginella moellendorffii140200442658230176432432412258
448970432624.675.844432624.675.844431149
Sorghum bicolorSb01g006820.1Sb09g025260.1Sb02g002090.1Sb07g007890.1Sb07g021300.1
Sb02g040200.1Sb04g028070.1Sb01g045850.1Sb04g006260.1Sb02g012870.1
Sb10g024640.1
Thellungiella halophilaThhalv10024573mThhalv10000073mThhalv10003763mThhalv10020204mThhalv10028486m
Thhalv10028476mThhalv10028475mThhalv10013220mThhalv10013221mThhalv10007266m
Thhalv10025412mThhalv10024828mThhalv10013578mThhalv10007269mThhalv10005891m
Thhalv10016754m
Vitis viniferaGSVIVT01033168001GSVIVT01016135001GSVIVT01032523001GSVIVT01009290001GSVIVT01002010001
GSVIVT01033767001GSVIVT01034719001GSVIVT01025737001GSVIVT01031405001
Volvox carteriVocar20003015m
Zea maysAC183932.3_FGT007
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)