y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna09044.1-v1.0-hybrid
FamilyCE10
Protein PropertiesLength: 722 Molecular Weight: 80438.8 Isoelectric Point: 6.0334
ChromosomeChromosome/Scaffold: 2 Start: 20851765 End: 20856732
Descriptionalpha/beta-Hydrolases superfamily protein
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE104746942.9e-27
  PSYQGTQDEKPPLLLKSHGGPTAEARGVLNLSIQYWTSRGWAFVDVNYGGSTGYGREYRERLLKKWGIVDVNDCCSCASYLVESGKVDGKRLCITGGSAG
  GYTTLAALAFRDTFKAGASLYGVADLNMLRAETHKFESRYLDNLVGSDQDYFDRSPINFVDKFSCPIILFQGLEDKVVPPDQARTIYRALKEKGLPVALV
  EYEGEQHGFRKAENIIFTLEQ
Full Sequence
Protein Sequence     Length: 722     Download
MALSSIATLT RFSTCSSSSS YHFHCISKRL RLIATVPAKT HHRNKMASSS PPESKKIAAP    60
FGSWKSPITA DVVSGASKRL GGTAVDSRGR LIWLESRPSE SGRAVLVREP ERPEDEPVDI    120
TPKDYAVRSL AQEYGGGAFR VSGDTVIFSN YKDQRLYKQS LSSKDSSPVP LTPDYGGPVV    180
SYADGVFDAR FNRFITVRED CRESSINSIT TIVTVRLDGN GIQESETLVG GSDFYAFPRL    240
DPKGERFAWI EWCHPNMPWD RSQLWVGYIS EKGDVTKRVC VSGSDPAIKE SPIEPKWSSK    300
GELFFITDRK SGFWNLYKWV ESTNEVISVY SLDAEFSKPL WVFGFNSYEF IESHEQKNLI    360
ACSYRQNGKS YIGIVDDVQG SLSLLNIPFT DIDNITLGIN CLYVEGASEV HPLSVAKVTL    420
DDQKSKAVEF KIIWSSSPDC LKYESYFSLP ELIEFPTEVP GQTAFAYFYP PTNPSYQGTQ    480
DEKPPLLLKS HGGPTAEARG VLNLSIQYWT SRGWAFVDVN YGGSTGYGRE YRERLLKKWG    540
IVDVNDCCSC ASYLVESGKV DGKRLCITGG SAGGYTTLAA LAFRDTFKAG ASLYGVADLN    600
MLRAETHKFE SRYLDNLVGS DQDYFDRSPI NFVDKFSCPI ILFQGLEDKV VPPDQARTIY    660
RALKEKGLPV ALVEYEGEQH GFRKAENIIF TLEQQMVFFA RLVGHFKVAD DISPIKIDNL    720
D*                                                                   780
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG1505COG15052.0e-8476701243+
COG0657Aes1.0e-8544682161+
COG0412COG04126.0e-10450682243+
pfam00326Peptidase_S92.0e-50506704204+
COG1506DAP22.0e-66212706502+
Gene Ontology
GO TermDescription
GO:0006508proteolysis
GO:0008152metabolic process
GO:0008236serine-type peptidase activity
GO:0016787hydrolase activity
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3azo_B0597045649A Chain A, Crystal Structure Of Puromycin Hydrolase
PDB3azo_A0597045649A Chain A, Crystal Structure Of Puromycin Hydrolase
PDB3azq_B0597045649A Chain A, Crystal Structure Of Puromycin Hydrolase
PDB3azq_A0597045649A Chain A, Crystal Structure Of Puromycin Hydrolase
PDB3azp_B0597045649A Chain A, Crystal Structure Of Puromycin Hydrolase S511a Mutant
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_017_00583.4Aquca_017_00583.3Aquca_017_00583.2Aquca_017_00583.1Aquca_015_00163.1
Arabidopsis lyrata915409859721
Arabidopsis thalianaAT4G14570.1AT5G36210.1
Brachypodium distachyonBradi3g26780.4Bradi3g26780.3Bradi3g26780.2Bradi3g26787.1Bradi1g45890.1
Brassica rapaBra039731Bra036867Bra037063Bra030822
Capsella rubellaCarubv10006608mCarubv10013057mCarubv10012695mCarubv10013077mCarubv10004231m
Chlamydomonas reinhardtiiCre05.g241650.t1.3Cre10.g423300.t1.1
Citrus clementinaCiclev10004377mCiclev10004325mCiclev10003676m
Citrus sinensisorange1.1g005093morange1.1g004149morange1.1g004141morange1.1g003363morange1.1g004816m
orange1.1g004757morange1.1g004756morange1.1g004735m
Cucumis sativusCucsa.386660.1Cucsa.123480.1Cucsa.123460.1
Eucalyptus grandisEucgr.H00222.1Eucgr.H00221.1Eucgr.F00026.5Eucgr.F00026.4Eucgr.F00026.3
Eucgr.F00026.2Eucgr.F00026.1Eucgr.F00028.1Eucgr.F00027.2Eucgr.F00027.1
Eucgr.L02208.1Eucgr.F00027.3Eucgr.F00025.1
Fragaria vescamrna29072.1-v1.0-hybridmrna32579.1-v1.0-hybridmrna09045.1-v1.0-hybrid
Glycine maxGlyma10g00350.1Glyma10g00320.1Glyma08g42730.1Glyma18g11480.3Glyma18g11480.2
Glyma18g11480.4
Gossypium raimondiiGorai.006G245500.5Gorai.006G245500.4Gorai.006G245500.3Gorai.006G245500.1Gorai.010G016900.1
Linum usitatissimumLus10039405Lus10015363Lus10032765Lus10021758
Malus domesticaMDP0000211874MDP0000304250MDP0000251803
Manihot esculentacassava4.1_002075mcassava4.1_031105mcassava4.1_005468m
Medicago truncatulaAC233668_48.1Medtr5g042400.2Medtr5g042400.1Medtr5g042410.1Medtr3g051310.1
Mimulus guttatusmgv1a001402mmgv1a001397mmgv1a002403m
Oryza sativaLOC_Os10g28020.3LOC_Os10g28020.1LOC_Os10g28020.2LOC_Os10g28030.2LOC_Os10g28030.1
LOC_Os06g11180.1
Panicum virgatumPavirv00008779mPavirv00061808mPavirv00015591mPavirv00045661mPavirv00003810m
Pavirv00003809m
Physcomitrella patensPp1s619_3V6.1Pp1s97_68V6.1Pp1s108_134V6.1Pp1s9_317V6.2Pp1s9_317V6.1
Pp1s139_36V6.2Pp1s139_36V6.1
Phaseolus vulgarisPhvul.007G279900.1Phvul.007G280000.1Phvul.006G042600.1Phvul.006G042700.1
Populus trichocarpaPotri.008G160400.1Potri.002G128700.9Potri.002G128700.8Potri.002G128700.7Potri.002G128700.6
Potri.002G128700.5Potri.002G128700.4Potri.002G128700.3Potri.002G128700.2Potri.002G128700.10
Potri.002G128700.1
Prunus persicappa001729mppa002365m
Ricinus communis29844.m00318230170.m01392428323.m000042
Setaria italicaSi034264mSi034356mSi006001mSi005937mSi005954m
Selaginella moellendorffii16830378836
Sorghum bicolorSb01g021970.4Sb01g021970.2Sb01g021970.1Sb01g021970.5Sb01g021960.1
Sb01g021970.3Sb10g007280.1Sb10g007270.1
Thellungiella halophilaThhalv10024477mThhalv10003712m
Vitis viniferaGSVIVT01018091001GSVIVT01009564001GSVIVT01009565001
Volvox carteriVocar20006950m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)