y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna09156.1-v1.0-hybrid
FamilyGT64
Protein PropertiesLength: 779 Molecular Weight: 87612.7 Isoelectric Point: 8.691
ChromosomeChromosome/Scaffold: 7 Start: 9062491 End: 9068332
Descriptionglycosyltransferase family protein 47
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT645327660
  FTLLTMTYDARLWNLKMYVKHYSRCSSVREIVVVWNKGIPPEVSDFDSAVPVRIRVEKQNSLNNRFRLDSLIKTRAVLELDDDIMMTCNDIERGFRIWRE
  HPDRIVGFYPRLIDGSPLKYRGEKYARSHKGYNMILTGAAFLESQVAFERYWSEEASQGRDLVDKFFNCEDVLMNYLYANASSSQNVEYVRPAWAIDTSK
  LSGAAISRNTQVHYNKRSNCLVKFSEMYGTLAGRK
Full Sequence
Protein Sequence     Length: 779     Download
MGFSPGGGGN GSANNNNNDN STSHHNNINN NTSSGGCCNM SLKCRLCKWR CLMSSGFVFF    60
FGCCVLFGSV ATFYVWFAFT PYYYARGTTP SALGCQEDNE GSWSVGVFFG DSPFHLKPIE    120
AMNVWRNKSA AWPVANPVVT CASLSESGFP SNFVADPFLY VQGDTLYMFY ETKNSITMQG    180
DIGVSKSSDK GATWQQLGIA LDEEWHLSYP YVFPYLGQIY MMPESSMNGE VRLYQALSFP    240
MQWTLEKVIL KKPLVDSFLI NYDGAYWLFG SDHSGFGTTK NGQLEIWYSS SPLGPWKPHK    300
KNPIYNGDRS VGARNGGRPF FYNGNLYRFG QDCAETYGKR VRTFKVEVLT KDEYKEVEVP    360
LGLPAPTKGR NAWNGVRFHH LDVQQLNTGG WIAVMDGDRV PSGDSVHRFI VGTASVAVVA    420
ILVISLGVLL GAVKCMIPLS WCTHNSGKRS DVFLACERSY FCSSKLRRFC SRLNRSVSFL    480
RGRIKPNTCA GRLVLAIYLA FGVAAMCTGV KYIYGGSGAE EAYPIKGHYS QFTLLTMTYD    540
ARLWNLKMYV KHYSRCSSVR EIVVVWNKGI PPEVSDFDSA VPVRIRVEKQ NSLNNRFRLD    600
SLIKTRAVLE LDDDIMMTCN DIERGFRIWR EHPDRIVGFY PRLIDGSPLK YRGEKYARSH    660
KGYNMILTGA AFLESQVAFE RYWSEEASQG RDLVDKFFNC EDVLMNYLYA NASSSQNVEY    720
VRPAWAIDTS KLSGAAISRN TQVHYNKRSN CLVKFSEMYG TLAGRKWEFD GRKDGWDV*     780
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam09258Glyco_transf_643.0e-69532762233+
Gene Ontology
GO TermDescription
GO:0016758transferase activity, transferring hexosyl groups
GO:0031227intrinsic to endoplasmic reticulum membrane
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1on8_B1e-2352075918267A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose
PDB1on8_A1e-2352075918267A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose
PDB1on6_B1e-2352075918267A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose
PDB1on6_A1e-2352075918267A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose
PDB1omz_B1e-2352075918267A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose
Transmembrane Domains
StartEnd
5779
409431
493515
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_018_00173.1Aquca_013_00497.1Aquca_004_00315.3Aquca_004_00315.1Aquca_004_00315.4
Aquca_004_00315.2Aquca_004_00315.5Aquca_009_01030.2Aquca_009_01030.1Aquca_019_00086.1
Aquca_009_01029.1
Arabidopsis lyrata340192908336
Arabidopsis thalianaAT1G80290.2AT1G80290.1AT3G55830.1AT5G04500.1
Brachypodium distachyonBradi3g40395.1Bradi1g34550.1Bradi1g12290.1Bradi1g34550.2Bradi2g18300.1
Brassica rapaBra008483Bra007194Bra009448Bra028787
Carica papayaevm.model.supercontig_488.3evm.model.supercontig_19.204evm.model.supercontig_4.178evm.model.supercontig_128.65
Capsella rubellaCarubv10016140mCarubv10017597mCarubv10003280m
Chlamydomonas reinhardtiiCre12.g508700.t1.2
Citrus clementinaCiclev10010680mCiclev10032067mCiclev10030719m
Citrus sinensisorange1.1g020041morange1.1g045656m
Cucumis sativusCucsa.311230.1Cucsa.368680.1Cucsa.308870.2Cucsa.308870.1
Eucalyptus grandisEucgr.C04240.1Eucgr.G03038.1Eucgr.K00135.1Eucgr.G02723.2Eucgr.G02723.1
Eucgr.K00135.2
Fragaria vescamrna08756.1-v1.0-hybridmrna20928.1-v1.0-hybridmrna21215.1-v1.0-hybrid
Glycine maxGlyma15g03130.1Glyma14g19550.1Glyma14g06670.1Glyma02g42230.1Glyma14g06670.2
Glyma09g27660.1Glyma16g32650.1Glyma09g27660.2Glyma10g34440.2Glyma20g33120.3
Glyma20g33120.2Glyma14g06670.3
Gossypium raimondiiGorai.008G132700.3Gorai.008G132700.2Gorai.008G132700.1Gorai.012G075900.1Gorai.009G307300.1
Gorai.012G075900.2
Linum usitatissimumLus10020174Lus10040216Lus10028274Lus10031680Lus10037920
Lus10038646Lus10027392
Malus domesticaMDP0000318911MDP0000177948MDP0000292999MDP0000138795MDP0000212600
MDP0000169420
Manihot esculentacassava4.1_010734mcassava4.1_011626mcassava4.1_011602mcassava4.1_011301mcassava4.1_013504m
cassava4.1_010773mcassava4.1_002721mcassava4.1_002024mcassava4.1_012021m
Medicago truncatulaMedtr1g009180.1Medtr5g082110.1
Mimulus guttatusmgv1a026874mmgv1a009961mmgv1a009124mmgv1a023379mmgv1a024929m
Oryza sativaLOC_Os06g49150.1LOC_Os03g48010.1LOC_Os05g46260.1
Panicum virgatumPavirv00045941mPavirv00020436mPavirv00023272mPavirv00018756mPavirv00050841m
Pavirv00045066mPavirv00036974mPavirv00061476m
Physcomitrella patensPp1s242_74V6.1Pp1s87_187V6.1Pp1s242_81V6.1Pp1s72_263V6.1Pp1s117_57V6.1
Phaseolus vulgarisPhvul.002G252600.1Phvul.008G225700.1Phvul.004G124500.1Phvul.007G144400.1
Picea abiesMA_277070g0010MA_140607g0010MA_30471g0010MA_948289g0010MA_8306453g0010
MA_10432291g0040
Populus trichocarpaPotri.006G278400.1Potri.010G191700.7Potri.010G191700.1Potri.008G065800.1Potri.010G191700.2
Potri.010G191700.5Potri.008G028900.2Potri.008G028900.1Potri.010G232700.3Potri.010G232700.2
Potri.010G232700.1Potri.010G191700.4Potri.010G191700.3Potri.010G191700.8Potri.010G191700.6
Prunus persicappa008992mppa008488mppa007532mppa002869m
Ricinus communis29589.m00129129669.m00081027916.m00015930147.m014149
Setaria italicaSi014019mSi006792mSi034429mSi021307m
Selaginella moellendorffii13310340321881258420395139351
Sorghum bicolorSb07g027170.1Sb10g029290.1Sb01g011790.1Sb09g026940.1
Thellungiella halophilaThhalv10000547mThhalv10010522mThhalv10012710m
Vitis viniferaGSVIVT01032860001GSVIVT01034672001
Volvox carteriVocar20000857m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)