y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna09360.1-v1.0-hybrid
FamilyGT77
Protein PropertiesLength: 318 Molecular Weight: 36419.2 Isoelectric Point: 9.7258
ChromosomeChromosome/Scaffold: 5 Start: 9936927 End: 9939087
DescriptionNucleotide-diphospho-sugar transferase family protein
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT77602770
  QDKVLVIAEDYGTLYKVNERWPGHAVLIPPALDAKAAHKFGSQGFFNFTSRRPRHLLNILELGYSVMYNDVDMVWLADPFPYLVGNHDVYFTDDMTPVKP
  LNHSHDLPPIGKKGRTYICSCMIFLRPTSGAKLIMKKWIEEMQQEPWSRAKKANDQPAFNWALDKNAAQADLYLLPQAAFPTGGLYFKNKTWVKETKGMH
  VIIHNNYILGFEKKIKRF
Full Sequence
Protein Sequence     Length: 318     Download
MQQGLFSITN KSQLKWRDYT LAQAAAFVAQ NGTLIVCAVS EPYLPFLNNW LISIARQKHQ    60
DKVLVIAEDY GTLYKVNERW PGHAVLIPPA LDAKAAHKFG SQGFFNFTSR RPRHLLNILE    120
LGYSVMYNDV DMVWLADPFP YLVGNHDVYF TDDMTPVKPL NHSHDLPPIG KKGRTYICSC    180
MIFLRPTSGA KLIMKKWIEE MQQEPWSRAK KANDQPAFNW ALDKNAAQAD LYLLPQAAFP    240
TGGLYFKNKT WVKETKGMHV IIHNNYILGF EKKIKRFHDY DLWLSSWKLR SKCLPPVCLT    300
FLYDGNSMEG KGREGKK*                                                  360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam03407Nucleotid_trans9.0e-4358277225+
Gene Ontology
GO TermDescription
GO:0005783endoplasmic reticulum
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_074_00044.1
Arabidopsis lyrata352664892838490401474813912111
Arabidopsis thalianaAT4G01220.1AT1G56550.1AT4G01750.1AT4G01220.2AT4G01770.1
Brachypodium distachyonBradi2g26850.1
Brassica rapaBra035432Bra036306Bra000906Bra039864Bra017900
Bra037377Bra000950Bra035431Bra000907
Carica papayaevm.model.supercontig_184.13
Capsella rubellaCarubv10001259mCarubv10001249mCarubv10021691m
Citrus clementinaCiclev10020808mCiclev10022071mCiclev10021218m
Citrus sinensisorange1.1g018302morange1.1g027009morange1.1g021054m
Cucumis sativusCucsa.135840.2Cucsa.135840.1
Eucalyptus grandisEucgr.E00084.1
Glycine maxGlyma08g09360.1
Gossypium raimondiiGorai.004G154200.4Gorai.007G104400.1Gorai.004G154200.1Gorai.004G154200.5Gorai.004G154200.3
Gorai.004G154200.2
Linum usitatissimumLus10002153Lus10012650Lus10008735
Malus domesticaMDP0000150593MDP0000264889
Manihot esculentacassava4.1_010616mcassava4.1_010633m
Mimulus guttatusmgv1a008876m
Oryza sativaLOC_Os05g32120.1
Panicum virgatumPavirv00063401mPavirv00048789m
Physcomitrella patensPp1s19_296V6.1
Phaseolus vulgarisPhvul.002G188500.1
Picea abiesMA_10233136g0010MA_173768g0010
Populus trichocarpaPotri.014G092400.2Potri.002G166000.1Potri.014G092400.1
Prunus persicappa007793m
Ricinus communis30174.m008682
Setaria italicaSi022588mSi017632m
Selaginella moellendorffii87970
Sorghum bicolorSb09g019070.1
Thellungiella halophilaThhalv10029467mThhalv10015591mThhalv10024021mThhalv10024115mThhalv10028748m
Vitis viniferaGSVIVT01016220001GSVIVT01027019001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny