y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna09449.1-v1.0-hybrid
FamilyGT28
Protein PropertiesLength: 857 Molecular Weight: 93406 Isoelectric Point: 6.2904
ChromosomeChromosome/Scaffold: 5 Start: 10400215 End: 10406352
DescriptionUDP-Glycosyltransferase superfamily protein
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT282494070
  LLVLGGSLGANAINIALLNLYYQMLLEKEDLFIIWQTGVEAYNEMESLVKNHPRLLLKPFMHKMDLAYAAADLVVSRAGAMTCYEILATGKPSILIPSPD
  ADEGHQFKNASLMADLAGARVITEDELDSTTLGNAIEEIVGDESKMADMSERALKAANV
Full Sequence
Protein Sequence     Length: 857     Download
MAAFSHLSFT PSPPPTKLGT LNFKVTSCLS LKQSNDQTLA SQNDAVLFDS LRVVFAAGGT    60
GGHIYPAVAI ADELKTTNPN AQILFFGIPK SMESKAIPNA GHDFAAVPAA KLHRPVLSPR    120
NVFLPYHLIK SIIWSYYKLR EFDPHIVIGT GGYVSFPVGI AAALRGVKLV IQEQNAVPGI    180
ANWLLSFLAE VVFVAFNSTI DCFPSASGKK CVVCGNPVRL SLRKNVSKEA ARGRFFPKCG    240
KEVEDVKVLL VLGGSLGANA INIALLNLYY QMLLEKEDLF IIWQTGVEAY NEMESLVKNH    300
PRLLLKPFMH KMDLAYAAAD LVVSRAGAMT CYEILATGKP SILIPSPDAD EGHQFKNASL    360
MADLAGARVI TEDELDSTTL GNAIEEIVGD ESKMADMSER ALKAANVNAS EEIAHHVARL    420
LELLPLRSSL LERDIIKNLS FILLTKGLMR NLVARKAESD KQPESGSSSS LPSCSKHGSD    480
LRSLTTAFGT DRPYFTPIRN SDPRPEPLRV SARRTPTPSA GVSLDLTKKN DPRWSVCTAD    540
ELHYVSVPNS DWNLALWRYL PSPQTTEPRN HPLLLLSGLA TNAIGYDLSP ESSFARSMSS    600
QGYDTWILEV RGAGLSTHGT ELGEINGLLE AGQNRATVVS GLSQTPLNIM EVGQRAVTSF    660
ADFQERFSTG LEDFQKQLGK LDWDFDHYLE EDVPVAADPA QVLNVPVPFG AIYTALHHLV    720
SRTPALSWLK PQVSAQDMMD PELYEKLVLN NFCTVPAKLL LQLATAFEEG GLCDRSGTFF    780
YKEHLCKSNV PILALGGDQD LICPPEAVYE TVKVIPEHLV TFKVLGELGG PHYAHYDLVG    840
GRGGLNSSFS NFLPYC*                                                   900
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam04101Glyco_tran_28_C3.0e-29258413157+
COG0707MurG1.0e-7452414364+
TIGR01133murG4.0e-8052414364+
PRK00726murG1.0e-10252417372+
cd03785GT1_MurG7.0e-11752414364+
Gene Ontology
GO TermDescription
GO:0005975carbohydrate metabolic process
GO:0016758transferase activity, transferring hexosyl groups
GO:0030246carbohydrate binding
GO:0030259lipid glycosylation
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3s2u_A9.80909e-45534225359A Chain A, Crystal Structure Of The Pseudomonas Aeruginosa Murg:udp-glcnac Substrate Comp
PDB1nlm_B2e-36524248357A Chain A, Crystal Structure Of The Pseudomonas Aeruginosa Murg:udp-glcnac Substrate Comp
PDB1nlm_A2e-36524248357A Chain A, Crystal Structure Of The Pseudomonas Aeruginosa Murg:udp-glcnac Substrate Comp
PDB1f0k_B2e-36524248357A Chain A, The 1.9 Angstrom Crystal Structure Of E. Coli Murg
PDB1f0k_A2e-36524248357A Chain A, The 1.9 Angstrom Crystal Structure Of E. Coli Murg
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_002_01253.1
Arabidopsis lyrata316317
Arabidopsis thalianaAT1G73740.1
Brachypodium distachyonBradi2g13780.1
Brassica rapaBra015969
Carica papayaevm.model.supercontig_3.458
Capsella rubellaCarubv10022300m
Chlamydomonas reinhardtiiCre12.g527950.t1.3
Citrus clementinaCiclev10020201m
Citrus sinensisorange1.1g031484m
Cucumis sativusCucsa.121750.1
Eucalyptus grandisEucgr.K02237.1
Glycine maxGlyma08g05420.2Glyma05g34250.2Glyma05g34250.3
Gossypium raimondiiGorai.001G067900.3Gorai.001G067900.1
Malus domesticaMDP0000880838MDP0000170708
Manihot esculentacassava4.1_029849m
Oryza sativaLOC_Os01g33230.1
Physcomitrella patensPp1s21_151V6.1
Phaseolus vulgarisPhvul.002G325300.1
Picea abiesMA_159099g0140
Populus trichocarpaPotri.012G053600.1
Prunus persicappa005855m
Ricinus communis29747.m00107734442.m000027
Setaria italicaSi001498m
Selaginella moellendorffii123054121052
Sorghum bicolorSb03g015470.1
Thellungiella halophilaThhalv10018574mThhalv10018576m
Vitis viniferaGSVIVT01008345001
Volvox carteriVocar20003855m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny