y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna09491.1-v1.0-hybrid
FamilyGH1
Protein PropertiesLength: 1443 Molecular Weight: 163174 Isoelectric Point: 5.346
ChromosomeChromosome/Scaffold: 5 Start: 10627819 End: 10638881
Descriptionalpha-N-acetylglucosaminidase family / NAGLU family
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH1111614400
  CISQEGIDHYNNVINEIVRNGIEPFVTLLHFDLPQASEDKNDFKDYSELCSKEFGDRVRYWFTINEPTVSVVYAYELEIAPPGRCSFKEGFCVFGAPPPG
  PCHAQQKGEIGAVLVAPYLIPYSDSPEDIAATERSYDFNLGWFLEPFVYGEYPKSMKVVVKERLPSFSAEEKSLIKGSLDFVGMNYYISSYVKSKQPSPT
  EEPRYTIEVAAEQTRQWKSAKRLEGLMVYIKEKYQNPKIYISENGLPMSRKDNSSLSERLKDSDRISYIAKHLYSQSGVNIRGYFYWSLFEWGMGLFESF
  GLHYDNLKRIPKQSAEWFQRFLQRN
GH891068450
  PQILISGVTGVEILAGLHWYLKNWCGSHISWDKTGGAQLFSVPKAGLLSCVGDGGILVQRPVPWNYYQNAVTSSYSLAWWDWIRWEKEIDMMALQGINLP
  LAFTGQEAIWQKVFQKFNISKSDLDDFFGGPAFLSWSRMGNLHGWGGPLPQSWLDQQLILQKRILDRMYELGMTPVLPAFSGNVPAALKTIYPAAKITQL
  GNWFSVKSDPRWTCTYLLDATDPLFVEIGKTFIEEQLKEYGRTSHIYNCDTFDENTPPVDDPEYISALGKTIFKGLQSGDKDGVWLMQGWLFSYDPFWRP
  AQMKALLHSVPAGRMVVLDLFAEVKPIWTTSEQFYGVPYIWKVIAPFLDWELAFFGIHYRCMLHNFAGNVEMYGVLDAIASGPIDAWTSENSTMVGVGMS
  MEGIEQNPVVYDLMSEMAFQQNKVDVKDWINLYSTRRYGRAVPLVQDAWSILRHTTYNCTDGAYRALRSLNSSTLQDCTAGSCSKKHAYTDKNRDVIVAF
  PDVDPSFIARPPQGYYQNEKSLVSRRAELLEEVTDSFERPHLWYSTSEVVHALELFIASGDELSGSNTYRYDLVDLTRQALAKYANELFLKVIEAYHLND
  TLEVVGLSQKFLELVEDMDTLLACHDGFLLGPWLESAKKLAQDKEQEIQFEWNARTQITMWFDNTEEEASLLRDYGNKYWSGLLRDYYGPRAAIYFKYLI
  KSLDEGSDFDLKNWRREWIKLTNDWQSSRNTFPVKSTGNA
Full Sequence
Protein Sequence     Length: 1443     Download
MASATSPAIS TVTIFTLFFF FTLCVLSSSS PSTIGVGYIS NVLELQDRER APPYVQVAAA    60
RGVLHRLLPS HSSSFDFQIV SKEQCGGASC FMIKNHPSFR RRGIDPQILI SGVTGVEILA    120
GLHWYLKNWC GSHISWDKTG GAQLFSVPKA GLLSCVGDGG ILVQRPVPWN YYQNAVTSSY    180
SLAWWDWIRW EKEIDMMALQ GINLPLAFTG QEAIWQKVFQ KFNISKSDLD DFFGGPAFLS    240
WSRMGNLHGW GGPLPQSWLD QQLILQKRIL DRMYELGMTP VLPAFSGNVP AALKTIYPAA    300
KITQLGNWFS VKSDPRWTCT YLLDATDPLF VEIGKTFIEE QLKEYGRTSH IYNCDTFDEN    360
TPPVDDPEYI SALGKTIFKG LQSGDKDGVW LMQGWLFSYD PFWRPAQMKA LLHSVPAGRM    420
VVLDLFAEVK PIWTTSEQFY GVPYIWKVIA PFLDWELAFF GIHYRCMLHN FAGNVEMYGV    480
LDAIASGPID AWTSENSTMV GVGMSMEGIE QNPVVYDLMS EMAFQQNKVD VKDWINLYST    540
RRYGRAVPLV QDAWSILRHT TYNCTDGAYR ALRSLNSSTL QDCTAGSCSK KHAYTDKNRD    600
VIVAFPDVDP SFIARPPQGY YQNEKSLVSR RAELLEEVTD SFERPHLWYS TSEVVHALEL    660
FIASGDELSG SNTYRYDLVD LTRQALAKYA NELFLKVIEA YHLNDTLEVV GLSQKFLELV    720
EDMDTLLACH DGFLLGPWLE SAKKLAQDKE QEIQFEWNAR TQITMWFDNT EEEASLLRDY    780
GNKYWSGLLR DYYGPRAAIY FKYLIKSLDE GSDFDLKNWR REWIKLTNDW QSSRNTFPVK    840
STGNASLVVF MPENGALVLT NGNIPEHDEK FRGAAKNNWT SIILVDGRSP ILLSSLTMDH    900
GDKKQSSTYG ETTSWADQWD YTNNNSSYPM DVKHGEQGTA AKCKQKVGEG LVKTKAVAST    960
GAKKVKDGAS SGFQWIKDKS VKAQETLLCT WILMEKNVVE SIWPMGNLSS ECMPSSFDIH    1020
RELLSFRLLI LIKVDDLGAV LGNFTAGGLT FQVSLNSSSF PREELDIKRS DIPSEFYFGV    1080
GTSAAQTEGS AKEGGRGSSI WDHFVEQNLD GSLSGCISQE GIDHYNNVIN EIVRNGIEPF    1140
VTLLHFDLPQ ASEDKNDFKD YSELCSKEFG DRVRYWFTIN EPTVSVVYAY ELEIAPPGRC    1200
SFKEGFCVFG APPPGPCHAQ QKGEIGAVLV APYLIPYSDS PEDIAATERS YDFNLGWFLE    1260
PFVYGEYPKS MKVVVKERLP SFSAEEKSLI KGSLDFVGMN YYISSYVKSK QPSPTEEPRY    1320
TIEVAAEQTR QWKSAKRLEG LMVYIKEKYQ NPKIYISENG LPMSRKDNSS LSERLKDSDR    1380
ISYIAKHLYS QSGVNIRGYF YWSLFEWGMG LFESFGLHYD NLKRIPKQSA EWFQRFLQRN    1440
DC*                                                                  1500
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02849PLN028496.0e-7610591442473+
TIGR03356BGL6.0e-8110731433433+
pfam12972NAGLU_C8.0e-85533845313+
pfam00232Glyco_hydro_13.0e-9910731440453+
pfam05089NAGLU2.0e-177171528358+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2vcc_A075834190850A Chain A, Structure Of The Thermostable Pectate Lyase Pl 47
PDB2vcb_A075834190850A Chain A, Structure Of The Thermostable Pectate Lyase Pl 47
PDB2vca_A075834190850A Chain A, Structure Of The Thermostable Pectate Lyase Pl 47
PDB2vc9_A075834190850A Chain A, Family 89 Glycoside Hydrolase From Clostridium Perfringens In Complex With 2-Acetamido-1,2-Dideoxynojirmycin
PDB4a4a_A075834213873A Chain A, Cpgh89 (E483q, E601q), From Clostridium Perfringens, In Complex With Its Substrate Glcnac-Alpha-1,4-Galactose
Transmembrane Domains
StartEnd
729
Signal Peptide
Cleavage Site
27
Hydropathy