y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna09620.1-v1.0-hybrid
FamilyGT1
Protein PropertiesLength: 483 Molecular Weight: 54368.1 Isoelectric Point: 5.785
ChromosomeChromosome/Scaffold: 6 Start: 9072270 End: 9073998
DescriptionUDP-Glycosyltransferase superfamily protein
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT12594352.9e-31
  PTEPTKSVVATNLMSEIDCTQWLKTKPQGSVLYVSFGSYCQVTKNEFEEIAQGLLLSKVSFIWVLRPDTISYEEEGYIVPFGFEDQISDRGLMVPWCSQI
  EVLSNPAIGGFLTHCGWNSILESMWFGVPMLCFPISTDQFTNRKLVVDDWRIGLNLCDRKPIARLEVAHKVNRLMNG
Full Sequence
Protein Sequence     Length: 483     Download
METNHPKPHA IMVPLSLQGH VNPFTHLAMK LASNGFTITF VNTEYFHHQI TKSKLNNTAQ    60
EQEQDDIFAA ARETGLDIRY RTVSDGFPLS FNRFQNLDQS LEGAIHVFPA HIDELVGDLV    120
QSDPSINCLI ADTFHTWTAM IANKHNLINI SFWTEPALVL NIYYHLDLLV KHGHFGCHDN    180
CEDTIDYIPG VQAIEPKDLT SHLHITNTSD PMLRIVKKAF REAKRADFIL CNTVQELEAE    240
SLSTLQDKQP TYAIGPVFPT EPTKSVVATN LMSEIDCTQW LKTKPQGSVL YVSFGSYCQV    300
TKNEFEEIAQ GLLLSKVSFI WVLRPDTISY EEEGYIVPFG FEDQISDRGL MVPWCSQIEV    360
LSNPAIGGFL THCGWNSILE SMWFGVPMLC FPISTDQFTN RKLVVDDWRI GLNLCDRKPI    420
ARLEVAHKVN RLMNGNLGDG ILQKEIKKAK QTLEDALSAN GSSQQSLCQF INDVKAKIQT    480
RI*                                                                  540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02410PLN024102.0e-551472480+
PLN02152PLN021524.0e-598474488+
PLN02173PLN021733.0e-615477491+
PLN02555PLN025559.0e-791482492+
PLN02448PLN024487.0e-1009474484+
Gene Ontology
GO TermDescription
GO:0008152metabolic process
GO:0016758transferase activity, transferring hexosyl groups
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2pq6_A074778480A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
PDB2vg8_A1.96182e-4484677460A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
PDB2vch_A1.96182e-4484677460A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
PDB2vce_A1.96182e-4484677460A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants
PDB2c9z_A2.99878e-437747463450A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_030_00088.1
Arabidopsis lyrata321400481703
Arabidopsis thalianaAT2G36970.1AT2G28080.1
Brachypodium distachyonBradi3g27610.1
Brassica rapaBra034386Bra005227Bra005229
Carica papayaevm.model.supercontig_1.23evm.model.supercontig_1.22
Capsella rubellaCarubv10023101mCarubv10025463m
Citrus clementinaCiclev10011571mCiclev10029902m
Citrus sinensisorange1.1g011789morange1.1g011724m
Cucumis sativusCucsa.385870.1
Eucalyptus grandisEucgr.B02537.1Eucgr.A01691.1
Fragaria vescamrna28972.1-v1.0-hybridmrna09619.1-v1.0-hybrid
Gossypium raimondiiGorai.003G144500.1
Linum usitatissimumLus10016127Lus10016128Lus10016126Lus10021438Lus10021437
Malus domesticaMDP0000184195MDP0000803674MDP0000148190MDP0000134856MDP0000696804
MDP0000279483MDP0000179216MDP0000128678
Manihot esculentacassava4.1_028045mcassava4.1_006927mcassava4.1_005956m
Mimulus guttatusmgv1a020724mmgv1a005852mmgv1a004928mmgv11b024665mmgv1a005283m
mgv1a005298mmgv1a005487mmgv1a005552mmgv1a023861mmgv1a004868m
mgv1a005354mmgv1a017916mmgv1a005271mmgv1a005954mmgv1a020141m
mgv1a026087mmgv1a019418m
Oryza sativaLOC_Os10g30560.1
Panicum virgatumPavirv00016210m
Picea abiesMA_20g0030MA_617328g0010MA_142317g0010MA_10436196g0010.108.287MA_10436196g0010.108.287
MA_57716g0010MA_10430346g0010MA_10436196g0010.563.731MA_10436196g0010.563.731MA_848089g0010
MA_343701g0010MA_111005g0010MA_10223011g0010MA_173000g0010MA_10281032g0010
MA_10259759g0010MA_10434721g0010MA_10434721g0020MA_10434576g0010MA_8498693g0010
MA_19907g0010MA_10426491g0010MA_220991g0010MA_10433786g0010MA_10108066g0010
MA_42695g0010MA_8452538g0010MA_10349694g0010MA_871006g0010MA_10434904g0020
Populus trichocarpaPotri.004G214100.2Potri.004G214100.1Potri.009G008100.1
Prunus persicappa004816mppa004829mppa020358mppa015843mppa023014m
ppa024090m
Ricinus communis29589.m001229
Setaria italicaSi035348mSi035373m
Sorghum bicolorSb01g020920.1
Thellungiella halophilaThhalv10016590mThhalv10016577mThhalv10017663m
Vitis viniferaGSVIVT01025724001GSVIVT01031515001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)