y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna09907.1-v1.0-hybrid
FamilyGH1
Protein PropertiesLength: 329 Molecular Weight: 37187.7 Isoelectric Point: 6.5756
ChromosomeChromosome/Scaffold: 4 Start: 13945993 End: 13950975
Descriptionbeta glucosidase 16
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH11393281.7e-30
  NNQEPRWHERCNSSTEAYIVSHNLILSHATAVKLYREKFQLNKVDKLDGVLKYTYGDYPKVMRHLVKERLPCFTEEEKSLVKGSFDFIGINYYTTRYGKN
  DPASQANDDLATSSETNANGVLIGPPAEGSVYIFSYPQEAKNDNLALDAQLRDPHRIDAFFRHLYRIKVAMKNGVNVKGYFHWAAFDDWE
Full Sequence
Protein Sequence     Length: 329     Download
MVKDSTKDNM CIVLIAYYSQ AAVDAHEGLH ANASDPEELN VKWTDFPNDF VFGVTTAAAQ    60
IEGSANEFGK GPSVWDKIVE VPENYGQIYH VYEHRFIQAI QVGGKISSEN HPYTFSPVTM    120
GHVKKRKVFV EAGTIATRNN QEPRWHERCN SSTEAYIVSH NLILSHATAV KLYREKFQLN    180
KVDKLDGVLK YTYGDYPKVM RHLVKERLPC FTEEEKSLVK GSFDFIGINY YTTRYGKNDP    240
ASQANDDLAT SSETNANGVL IGPPAEGSVY IFSYPQEAKN DNLALDAQLR DPHRIDAFFR    300
HLYRIKVAMK NGVNVKGYFH WAAFDDWE*                                      360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02849PLN028492.0e-5447633+
pfam00232Glyco_hydro_11.0e-9468439+
PLN02814PLN028143.0e-22150328230+
PLN02849PLN028492.0e-22150328235+
pfam00232Glyco_hydro_11.0e-24151328235+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3ptq_B2e-29150328229468A Chain A, Crystal Structure And Enzymatic Properties Of A Bacterial Family 19 Chitinase Reveal Differences With Plant Enzymes
PDB3ptq_A2e-29150328229468A Chain A, Crystal Structure And Enzymatic Properties Of A Bacterial Family 19 Chitinase Reveal Differences With Plant Enzymes
PDB3ptm_B2e-29150328229468A Chain A, Crystal Structure And Enzymatic Properties Of A Bacterial Family 19 Chitinase Reveal Differences With Plant Enzymes
PDB3ptm_A2e-29150328229468A Chain A, Crystal Structure And Enzymatic Properties Of A Bacterial Family 19 Chitinase Reveal Differences With Plant Enzymes
PDB3ptk_B2e-29150328229468A Chain A, The Crystal Structure Of Rice (Oryza Sativa L.) Os4bglu12
Hydropathy
Orthologous Group
SpeciesID
Fragaria vescamrna06375.1-v1.0-hybrid
Malus domesticaMDP0000320822.209.384MDP0000320822.209.384
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny