y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna10336.1-v1.0-hybrid
FamilyCBM43
Protein PropertiesLength: 177 Molecular Weight: 18564 Isoelectric Point: 8.379
ChromosomeChromosome/Scaffold: 6 Start: 32193511 End: 32194295
DescriptionO-Glycosyl hydrolases family 17 protein
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CBM43921712.1e-21
  WCIAKGGIPKTLLKNDFDSLCKEVDCSPTNGTGLCYTESIFAKASFAMNLKYQKNGKKDADCVYEGRAETTTKDPSWGKC
Full Sequence
Protein Sequence     Length: 177     Download
METKSIIVSL LILQLAVTAF SKGGHKGKGG GGHHRDQNPM HQPHGSHKDV HEPGGPAGGI    60
AKPGSKPQVE FGGVDEQFAP SSGGDASGDK KWCIAKGGIP KTLLKNDFDS LCKEVDCSPT    120
NGTGLCYTES IFAKASFAMN LKYQKNGKKD ADCVYEGRAE TTTKDPSWGK CIMVSS*       180
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam07983X83.0e-109115976+
smart00768X81.0e-199117284+
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2jon_A0.0000000009911751298A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9
Signal Peptide
Cleavage Site
21
Hydropathy
Orthologous Group
SpeciesID
Fragaria vescamrna26604.1-v1.0-hybrid.222.303mrna26604.1-v1.0-hybrid.222.303mrna26604.1-v1.0-hybrid.222.303mrna26604.1-v1.0-hybrid.128.194mrna26604.1-v1.0-hybrid.128.194
mrna26604.1-v1.0-hybrid.128.194mrna28256.1-v1.0-hybrid
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny