y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna10342.1-v1.0-hybrid
FamilyCE10
Protein PropertiesLength: 507 Molecular Weight: 56151.7 Isoelectric Point: 7.5183
ChromosomeChromosome/Scaffold: 6 Start: 32222844 End: 32226857
Descriptionprenylcysteine methylesterase
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE102304720
  VQRSIVYGDQPRNRLDLYFPKNTDGKKPVVVFVTGGAWIIGYKAWGSLLGMQLAERNIIVACIDYRNFPQGTISDMVEDASRGISYICNNIADYGGDPDR
  IYLMGQSAGAHISSCALLEQAIKESKKEEISWSVSQIKAYFGLSGGIMEGEESFHRFSPEVRVQDPGNKDAVSILPPITLFHGTADYSIPSDASKIFVDV
  LQRVGAQADLVLYDGKTHTDLFLQDPLRGGKDDLFDQLVAVIH
Full Sequence
Protein Sequence     Length: 507     Download
MVTPADGSYF VPDSCPSPFS IPLRLTPPNS TKPPDFSHRA EISFWRLLHC LLPWPSITKM    60
VFCILISILS VFVVAHAFLI FIFLRFTTTS LSDSIVKKMK LESPTESTAS SLRQSASSAV    120
AEELMEMETK PLLTKVLSYP PAATASIGQR RRTKSSPATP RPSRQNSFSR DIGHAAKETY    180
LVTSLSFTLL QYLGVGYRWI TRLLALYCYA MLLMPGFLQV AYLYYFSSQV QRSIVYGDQP    240
RNRLDLYFPK NTDGKKPVVV FVTGGAWIIG YKAWGSLLGM QLAERNIIVA CIDYRNFPQG    300
TISDMVEDAS RGISYICNNI ADYGGDPDRI YLMGQSAGAH ISSCALLEQA IKESKKEEIS    360
WSVSQIKAYF GLSGGIMEGE ESFHRFSPEV RVQDPGNKDA VSILPPITLF HGTADYSIPS    420
DASKIFVDVL QRVGAQADLV LYDGKTHTDL FLQDPLRGGK DDLFDQLVAV IHADDKEALE    480
QDAVAPPRRR LVPEILLKLA GNISPF*                                        540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd00312Esterase_lipase1.0e-9244347118+
pfam00135COesterase3.0e-10244347127+
COG2272PnbA2.0e-10244347118+
pfam07859Abhydrolase_31.0e-11259447210+
COG0657Aes6.0e-24234447235+
Gene Ontology
GO TermDescription
GO:0006508proteolysis
GO:0008152metabolic process
GO:0008236serine-type peptidase activity
GO:0016787hydrolase activity
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2hm7_A0.00000000424344761282A Chain A, Crystal Structure Analysis Of The G84s Est2 Mutant
PDB1f6w_A0.00000000522636565231A Chain A, Structure Of The Catalytic Domain Of Human Bile Salt Activated Lipase
PDB1evq_A0.00000000624344761282A Chain A, The Crystal Structure Of The Thermophilic Carboxylesterase Est2 From Alicyclobacillus Acidocaldarius
PDB2bce_A0.00000000923536574231A Chain A, Cholesterol Esterase From Bos Taurus
PDB1thg_A0.00000001244339108220A Chain A, 1.8 Angstroms Refined Structure Of The Lipase From Geotrichum Candidum
Transmembrane Domains
StartEnd
6183
203225
257279
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_002_01054.1Aquca_026_00158.1Aquca_002_01054.2Aquca_002_01054.3
Arabidopsis lyrata472805488435871523
Arabidopsis thalianaAT5G15860.1AT3G02410.2AT3G02410.1AT1G26120.1AT5G15860.2
Brachypodium distachyonBradi2g44942.1Bradi1g34707.1Bradi2g15577.1
Brassica rapaBra023542Bra039174Bra024729Bra011010
Carica papayaevm.model.supercontig_179.40evm.model.supercontig_1.241
Capsella rubellaCarubv10009035mCarubv10013836mCarubv10001044m
Chlamydomonas reinhardtiiCre02.g119050.t1.3Cre02.g119100.t1.2Cre04.g221000.t1.2
Citrus clementinaCiclev10031407mCiclev10012228mCiclev10012226mCiclev10011876mCiclev10031505m
Ciclev10032121m
Citrus sinensisorange1.1g011866morange1.1g021014morange1.1g015512morange1.1g015857morange1.1g015669m
orange1.1g012898morange1.1g027370morange1.1g020616m
Cucumis sativusCucsa.284050.2Cucsa.284050.1Cucsa.031590.2Cucsa.031590.1Cucsa.031590.3
Cucsa.023750.1
Eucalyptus grandisEucgr.J01457.1Eucgr.B03069.1Eucgr.B03069.3Eucgr.B03069.2
Fragaria vescamrna04471.1-v1.0-hybrid
Glycine maxGlyma16g18930.1Glyma19g05450.1
Gossypium raimondiiGorai.013G079100.1Gorai.001G082500.7Gorai.001G082500.4Gorai.001G082500.3Gorai.001G082500.2
Gorai.001G082500.10Gorai.001G082500.1Gorai.001G082500.5Gorai.001G082500.8Gorai.001G082500.6
Gorai.013G079100.2Gorai.001G082500.9Gorai.001G082500.11
Linum usitatissimumLus10034399Lus10034083Lus10035064Lus10003065Lus10017889
Lus10019156
Malus domesticaMDP0000150270MDP0000199618MDP0000148927
Manihot esculentacassava4.1_007743mcassava4.1_008765m
Medicago truncatulaAC233657_38.1
Mimulus guttatusmgv1a005715mmgv1a006071mmgv1a007008m
Oryza sativaLOC_Os06g49440.1LOC_Os05g50170.2LOC_Os05g50170.1LOC_Os01g45460.1
Panicum virgatumPavirv00062556mPavirv00037181mPavirv00069964mPavirv00069963mPavirv00008713m
Pavirv00033569mPavirv00037182mPavirv00029918m
Physcomitrella patensPp1s196_45V6.1Pp1s62_226V6.1Pp1s74_172V6.1Pp1s131_174V6.1
Phaseolus vulgarisPhvul.003G282000.1Phvul.002G197000.1
Picea abiesMA_10277324g0010
Populus trichocarpaPotri.004G104800.4Potri.004G104800.2Potri.004G104800.1Potri.T099800.1Potri.017G110700.2
Potri.017G110700.1Potri.010G132200.3Potri.010G132200.2Potri.010G132200.1Potri.004G104800.3
Potri.010G132200.4Potri.004G104800.5
Prunus persicappa006567mppa005357m
Ricinus communis28583.m00011030138.m00382932825.m000025
Setaria italicaSi006248mSi001677mSi001674mSi025328m
Selaginella moellendorffii17024680622
Sorghum bicolorSb10g029410.1Sb03g029280.1
Thellungiella halophilaThhalv10013599mThhalv10020771mThhalv10007556m
Vitis viniferaGSVIVT01030706001GSVIVT01012000001
Volvox carteriVocar20003581mVocar20003648m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)