y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna10569.1-v1.0-hybrid
FamilyGT58
Protein PropertiesLength: 405 Molecular Weight: 45479.2 Isoelectric Point: 10.0817
ChromosomeChromosome/Scaffold: 2 Start: 15774461 End: 15777290
Descriptionasparagine-linked glycosylation 3
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT58353690
  SALLVFDAVLTALIIAYVPYTKIDWDAYMSQVSGFIGGERDYSNLKGDTGPLVYPAGFLYAYSAIQYVTGSQVHPAQILFGVLYIVNLGIMLYIYLKTDV
  VPWWALALLCLSKRMHSIFVLRLFNDCLAMLLLHASLASFLHQSGAVSIKMNVLLYAPPLLLLMLKAMDISGVISALFGAALVQILLGLPFIMSHPVAYI
  SRAFNLGRVFIHFWSVNFKFVPEPIFVSKAFAISLLVVHLVLLAAFAHYRWCKHEGGVFKFLYSRLVSIKLKFALTNTRSYKALKKEYIVTTMFVGNFIG
  ILCARSLHYQFYSWVILFTGVELCWNVYPSNLYSS
Full Sequence
Protein Sequence     Length: 405     Download
MAVKSARRAK SSQHRQISKA WIPKLFRNPK VASASALLVF DAVLTALIIA YVPYTKIDWD    60
AYMSQVSGFI GGERDYSNLK GDTGPLVYPA GFLYAYSAIQ YVTGSQVHPA QILFGVLYIV    120
NLGIMLYIYL KTDVVPWWAL ALLCLSKRMH SIFVLRLFND CLAMLLLHAS LASFLHQSGA    180
VSIKMNVLLY APPLLLLMLK AMDISGVISA LFGAALVQIL LGLPFIMSHP VAYISRAFNL    240
GRVFIHFWSV NFKFVPEPIF VSKAFAISLL VVHLVLLAAF AHYRWCKHEG GVFKFLYSRL    300
VSIKLKFALT NTRSYKALKK EYIVTTMFVG NFIGILCARS LHYQFYSWVI LFTGVELCWN    360
VYPSNLYSSA LLLGLHLVIL FGLWSAPSEY PYVDKKVSTQ DKHK*                    420
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam05208ALG31.0e-11634363361+
Gene Ontology
GO TermDescription
GO:0005783endoplasmic reticulum
GO:0016021integral to membrane
GO:0016758transferase activity, transferring hexosyl groups
Transmembrane Domains
StartEnd
3153
108130
153175
180199
206228
259281
321343
366388
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_003_00758.1Aquca_003_00758.2Aquca_003_00758.3
Arabidopsis lyrata904250
Arabidopsis thalianaAT2G47760.3AT2G47760.1AT2G47760.2
Brachypodium distachyonBradi2g04440.1
Brassica rapaBra000461.29.139Bra004431
Carica papayaevm.model.supercontig_9.209
Capsella rubellaCarubv10023173m
Citrus clementinaCiclev10020260m
Citrus sinensisorange1.1g014346morange1.1g015618m.102.369orange1.1g015618m.102.369orange1.1g015618m.30.104orange1.1g015618m.30.104
Cucumis sativusCucsa.205720.1
Eucalyptus grandisEucgr.H01160.1
Glycine maxGlyma19g39740.1Glyma03g37130.1
Gossypium raimondiiGorai.008G011100.2Gorai.008G011100.1
Linum usitatissimumLus10031921Lus10035085
Malus domesticaMDP0000161757
Manihot esculentacassava4.1_008035m
Medicago truncatulaMedtr7g108620.1
Mimulus guttatusmgv1a006267mmgv1a008112m
Oryza sativaLOC_Os01g07720.4LOC_Os01g07720.2
Panicum virgatumPavirv00058096mPavirv00012164m
Physcomitrella patensPp1s58_150V6.1
Phaseolus vulgarisPhvul.001G205800.1
Picea abiesMA_10426799g0010
Populus trichocarpaPotri.014G131600.2Potri.014G131600.1Potri.014G131600.3
Prunus persicappa005841m
Ricinus communis30129.m000370
Setaria italicaSi001564m
Selaginella moellendorffii96090
Sorghum bicolorSb03g004440.1
Thellungiella halophilaThhalv10001458m
Vitis viniferaGSVIVT01027976001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny