y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna10854.1-v1.0-hybrid
FamilyCE8
Protein PropertiesLength: 270 Molecular Weight: 28886.4 Isoelectric Point: 4.9437
ChromosomeChromosome/Scaffold: 5 Start: 13090202 End: 13091894
DescriptionPlant invertase/pectin methylesterase inhibitor superfamily
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE8482680
  DMVVAKNGPANFTTIGDAIKAAPNNSLKRINIKVMAGVYDEYIVVEAEKTNLTIIGEGIDKTIITGNRSNATGFGTYYSATIGIQGYGFIAQDLTLENTA
  GPEGGQAVSLLSESYNSVYFRCKISDYQDTLYAKEGVQFFKGCEIYGTVDFIFGNSQVFFQGCNVYARKPVKGQSITITAQGRESSSDSTGTVFQNCTFR
  ATSELITSGFPVDGYLGRPWR
Full Sequence
Protein Sequence     Length: 270     Download
MSPDGGGNSA AEDGGRDRLR RAGVLTLVSL SRSPLKELAV GQEEIGFDMV VAKNGPANFT    60
TIGDAIKAAP NNSLKRINIK VMAGVYDEYI VVEAEKTNLT IIGEGIDKTI ITGNRSNATG    120
FGTYYSATIG IQGYGFIAQD LTLENTAGPE GGQAVSLLSE SYNSVYFRCK ISDYQDTLYA    180
KEGVQFFKGC EIYGTVDFIF GNSQVFFQGC NVYARKPVKG QSITITAQGR ESSSDSTGTV    240
FQNCTFRATS ELITSGFPVD GYLGRPWRA*                                     300
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02201PLN022013.0e-7345268224+
PLN02933PLN029331.0e-7330268239+
PLN02416PLN024164.0e-7649268220+
PLN02713PLN027132.0e-8029268243+
pfam01095Pectinesterase2.0e-10048268221+
Gene Ontology
GO TermDescription
GO:0005618cell wall
GO:0030599pectinesterase activity
GO:0042545cell wall modification
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1gq8_A0452685228A Chain A, Pectin Methylesterase From Carrot
PDB1xg2_A0482684224B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein
PDB3uw0_A6e-215926844270A Chain A, Pectin Methylesterase From Yersinia Enterocolitica
PDB1qjv_B5e-19472684246A Chain A, Pectin Methylesterase Pema From Erwinia Chrysanthemi
PDB1qjv_A5e-19472684246A Chain A, Pectin Methylesterase Pema From Erwinia Chrysanthemi
Hydropathy