y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna10921.1-v1.0-hybrid
FamilyGT77
Protein PropertiesLength: 665 Molecular Weight: 75514.9 Isoelectric Point: 6.4561
ChromosomeChromosome/Scaffold: 5 Start: 17384517 End: 17390537
Descriptionxyloglucanase 113
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT771443680
  ISNLLVGAMDTKLLEALYWKGVPVFDMGSHMSTIDVGWGSPTFHKMGREKVILIDSILLYGFELLMCDTDMVWLKNPLPFLARYPEADVLTSSDQVVPTV
  ADDRLDIWQQVGAAYNIGIFHWRPTDPAKKLAKEWKEMLLADDKIWDQNGFNDLVRKQLGPAVDGESELVYAYDGSLKLGILPASIFCSGHTYFVQAMYQ
  QLRLEPYAVHTTFQYAGTDGKRHRL
Full Sequence
Protein Sequence     Length: 665     Download
MGWRNAFDNS KPLFVAVYAT VIVGIIFSSL YVISAIYSGK AATFSATSFQ NNVGSSPSEQ    60
ALNVSQSAVV QGVPSPNLES RNVSTKPIWE APNTKKMPEL ETFRLTKELV QQRVKDNVVI    120
VTFGNYAFMD FILTWVKHLT DLGISNLLVG AMDTKLLEAL YWKGVPVFDM GSHMSTIDVG    180
WGSPTFHKMG REKVILIDSI LLYGFELLMC DTDMVWLKNP LPFLARYPEA DVLTSSDQVV    240
PTVADDRLDI WQQVGAAYNI GIFHWRPTDP AKKLAKEWKE MLLADDKIWD QNGFNDLVRK    300
QLGPAVDGES ELVYAYDGSL KLGILPASIF CSGHTYFVQA MYQQLRLEPY AVHTTFQYAG    360
TDGKRHRLRE GMVFFDPPEY YDAPGGFLTF KPSIPKNLLL EGPHTVESHF TLVNYQIKQI    420
RMALAIASVL NRTLVMPPLW CRLDRLWFPH PGVLEGSLTR QPFLCPLDHV FEVNIMLKEL    480
PVEEFGPQIN IREYSFFDNP LMPKQVKDSW LEVQLCQEGI RDCLASNNTS PSGVLRFPKR    540
SSEETLMSWS DSNLAFEVKK YYDSMFKTVF SSFKDVKVIK FSSMQDAFLG FADKASLSIS    600
SSNLIWAKPI REERFRNRVK RYVGIWCCVA EQTPGHIYYD MYWDEKPGWK PLPPQTPQDD    660
HPPP*                                                                720
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam03407Nucleotid_trans3.0e-50144368231+
Gene Ontology
GO TermDescription
GO:0005783endoplasmic reticulum
Transmembrane Domains
StartEnd
1335
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_011_00317.5Aquca_011_00317.4Aquca_011_00317.3Aquca_011_00317.2Aquca_011_00317.1
Arabidopsis lyrata902666
Arabidopsis thalianaAT2G35610.1
Brachypodium distachyonBradi1g15410.1Bradi3g45950.1
Brassica rapaBra017310Bra005325
Carica papayaevm.model.supercontig_90.39
Capsella rubellaCarubv10022808m
Chlamydomonas reinhardtiig13982.t1g15149.t1Cre02.g082950.t1.3Cre01.g000400.t1.2Cre01.g000450.t1.2
g4580.t1Cre07.g340950.t1.3Cre04.g224350.t1.3Cre01.g000500.t1.3Cre09.g416650.t1.2
Cre13.g574100.t1.2Cre13.g574041.t1.1Cre13.g574050.t1.2Cre07.g332500.t1.2
Citrus clementinaCiclev10011269m
Citrus sinensisorange1.1g036925m
Cucumis sativusCucsa.018320.1Cucsa.018320.10Cucsa.018320.3
Eucalyptus grandisEucgr.E01147.2Eucgr.E01147.1
Glycine maxGlyma11g09650.2Glyma01g35690.1Glyma16g08350.1Glyma16g20730.1Glyma16g08350.3
Glyma16g08350.2
Gossypium raimondiiGorai.004G177500.4Gorai.008G219000.2Gorai.004G177500.5Gorai.004G177500.6Gorai.004G177500.7
Gorai.004G177500.9Gorai.004G177500.2Gorai.004G177500.3Gorai.004G177500.1Gorai.008G219000.1
Gorai.004G177500.8
Linum usitatissimumLus10005034Lus10027804
Malus domesticaMDP0000349223
Manihot esculentacassava4.1_003398mcassava4.1_008884m
Medicago truncatulaMedtr8g072310.1Medtr5g025590.1
Mimulus guttatusmgv1a002766m
Oryza sativaLOC_Os03g38930.1
Panicum virgatumPavirv00057126mPavirv00045617mPavirv00069114m
Physcomitrella patensPp1s46_165V6.1
Phaseolus vulgarisPhvul.003G278500.1Phvul.002G122000.1
Picea abiesMA_486176g0010MA_10433213g0010
Populus trichocarpaPotri.004G235800.1Potri.004G235800.2
Prunus persicappa002815m
Ricinus communis29827.m002651
Setaria italicaSi034728m
Selaginella moellendorffii127789
Sorghum bicolorSb01g015590.1
Thellungiella halophilaThhalv10016368m
Vitis viniferaGSVIVT01036881001
Volvox carteriVocar20007251mVocar20009385mVocar20010418mVocar20002020mVocar20004159m
Vocar20001219mVocar20001335mVocar20001723mVocar20006862mVocar20009663m
Vocar20008350mVocar20001348m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)