y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna11048.1-v1.0-hybrid
FamilyGT24
Protein PropertiesLength: 1613 Molecular Weight: 181555 Isoelectric Point: 5.7727
ChromosomeChromosome/Scaffold: 5 Start: 20646017 End: 20666405
DescriptionUDP-glucose:glycoprotein glucosyltransferases;transferases, transferring hexosyl groups;transferases, transferring glycosyl groups
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT24131015540
  INIFSIASGHLYERFLKIMILSVLKNTRRPVKFWFIKNYLSPQFKDVIPRMADEYGFEYQLITYKWPTWLHKQKEKQRIIWAYKILFLDVIFPLSLEKVI
  FVDADQIIRADMGELYDMDIKGRPLAYTPFCDNNKDMDGYRFWRQVLTDKGLFPFFILLAVMDCPISNISIVFTCALYVVDLKKFRETAAGDNLRDLPNY
  AQHTVPIFSLPQEWLWCESWCGNATKSKAKTIDLCNNPMTKEPKL
Full Sequence
Protein Sequence     Length: 1613     Download
MGTRLAYAFI ILICLIGSVS AQNRRPKNVQ VAVRAKWSAT PLLLEAGELL SREHKDNFWE    60
FIDIWHHSDK DDLDSYNAKG CLKTILKHGR SILSEPLASL FEFSLTLRSA SPRLVLYRQL    120
AEESLSSFPL VDETNSRSTS GNSETNEHVE IRKSDHLDVG LNPKSPNGKC CWVDTGGALF    180
FDAAELKSWL HSPKDCSRDS FQQPELFEFD HIHFDSTVGS PVAVLYGALG TGCFREFHVT    240
LVEAAKEGHV KYVVRPVLPS GCEAEIDRCG AVGAKDSLNL GGYGVELALK NMEYKAMDDS    300
TIKKGVTLED PRTEDLSQEV RGFIFSKFLK FGGGSILDRF NGERTIFETV RGKERRPELT    360
SEIMAFRDYL LSSIISDTLD VWELKDLGHQ TAQRIVQATD PLQAMQEINQ NFPTVVSSLS    420
RMKLNDSVKD EITANQRMIP PGKSLMAMNG ALINIEDVDL YLLVDLVHQD LLLADHFSKL    480
KIPHSTARKL LSTLPPPESN MFRVDFRSNH VHYLNNLEED AMYKRWRSNL NEVGLLSVSI    540
LMPVFPGQLR YIRKNLFHAV SVIDPSTSID MLISLYENNF PMRFGVVLYS SKLIKHIETS    600
SDDSQIEEDI STSIKKLRGE SDGSADDLEM HHVEGAFVET VLPKVKSPPQ GILLKLEREQ    660
TYKERAHEST IFVFKLGLAK LQCCLLMNGL VLDSNEEALT NSMNDEMPRI QEQVYYGHIN    720
SQTDVLNKFL SESGTTRYNP QIIAGGKPRF TSLCTSVLGG EGVFNDISYL HSPETVDDLK    780
PVTHLLVVDV SSKKGMKLIH EALQYLIEGS DRARVGVLFS VNQGADLSTL LFVEVFQITA    840
SLHRCVCSFF EQNHMLAPSE GAEITQAFID KVSELAEKNG LSSKAYKSAL SDFSAEELRK    900
RLNKVAQFLY RQLGLDSGVN GVITNGRVTV VNEESSLLSH DLSLLESVEF TQRIKHIVEI    960
IEEVKWQDVD PDTLTSKFIS DTIMFVSSSM AMRDRSSEGA RFEVLNADYS AIVLNNENSS    1020
IHIDAVIDPL SPSGQKLSSI LRVLWKYVQP SMRIVLNPLS SLVDLPLKNY YRYVVPTVDD    1080
FSTTDYTVNG PKAFFANMPL SKTLTMNLDV PDPWLVEPVI AVHDLDNILL ENLGETRTLQ    1140
AVFELEALVL TGHCSEKDHD PPRGLQLIIG TKSAPHLVDT LVMANLGYWQ MKVSPGVWYL    1200
QLAPGRSSEL YVLKDEGDGS QSKTLSKRIT INDLRGTVVH LEVVKKKGKE HEKLLLSDVN    1260
EKTQDATEGN SWNSNFIKWA SGLIGGSEHS KQSENTSWEK GKGGRHGKTI NIFSIASGHL    1320
YERFLKIMIL SVLKNTRRPV KFWFIKNYLS PQFKDVIPRM ADEYGFEYQL ITYKWPTWLH    1380
KQKEKQRIIW AYKILFLDVI FPLSLEKVIF VDADQIIRAD MGELYDMDIK GRPLAYTPFC    1440
DNNKDMDGYR FWRQVLTDKG LFPFFILLAV MDCPISNISI VFTCALYVVD LKKFRETAAG    1500
DNLRDLPNYA QHTVPIFSLP QEWLWCESWC GNATKSKAKT IDLCNNPMTK EPKLQGARRI    1560
VSEWPDLDLE ARQFTAKILG DEVAIQEPPP DPNQPGSVMD SPPEDLESKA EL*           1620
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam01501Glyco_transf_82.0e-513141435128+
cd04194GT8_A4GalT_like2.0e-1113101435128+
cd00505Glyco_transf_81.0e-4613101554269+
pfam06427UDP-g_GGTase1.0e-789801185212+
cd06432GT8_HUGT1_C_like8.0e-14013101554265+
Gene Ontology
GO TermDescription
GO:0003980UDP-glucose:glycoprotein glucosyltransferase activity
GO:0006486protein glycosylation
Transmembrane Domains
StartEnd
522
Signal Peptide
Cleavage Site
21
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_023_00011.1
Arabidopsis lyrata894960
Arabidopsis thalianaAT1G71220.2AT1G71220.1
Brachypodium distachyonBradi3g28605.1
Brassica rapaBra016154
Capsella rubellaCarubv10022452m
Chlamydomonas reinhardtiig5108.t1g5108.t2
Citrus clementinaCiclev10000024m
Citrus sinensisorange1.1g001078morange1.1g000334morange1.1g000842morange1.1g001779morange1.1g000402m
orange1.1g000446morange1.1g000445m
Cucumis sativusCucsa.033020.2Cucsa.033020.1
Eucalyptus grandisEucgr.H01580.1Eucgr.I02739.1Eucgr.H01552.1.95.175Eucgr.H01552.1.95.175
Glycine maxGlyma20g20260.1Glyma05g30230.1Glyma08g20020.1Glyma08g20020.2Glyma08g13400.1
Gossypium raimondiiGorai.012G151700.5Gorai.008G027900.1Gorai.012G151700.3Gorai.012G151700.2Gorai.012G151700.4
Linum usitatissimumLus10019946Lus10015475
Malus domesticaMDP0000231077MDP0000439201
Manihot esculentacassava4.1_000150m
Medicago truncatulaMedtr2g006960.1
Mimulus guttatusmgv1a000151m
Oryza sativaLOC_Os02g44510.3LOC_Os02g44510.2LOC_Os02g44510.1
Panicum virgatumPavirv00007561mPavirv00061408m
Physcomitrella patensPp1s25_65V6.1
Phaseolus vulgarisPhvul.006G215600.1
Picea abiesMA_10435601g0010
Populus trichocarpaPotri.003G018900.1
Prunus persicappa000323m
Ricinus communis29222.m000396
Setaria italicaSi033881m
Selaginella moellendorffii186368
Sorghum bicolorSb04g036540.1
Thellungiella halophilaThhalv10018004m
Vitis viniferaGSVIVT01022867001
Volvox carteriVocar20012786m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny