y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna11058.1-v1.0-hybrid
FamilyCBM49
Protein PropertiesLength: 626 Molecular Weight: 69261 Isoelectric Point: 6.2402
ChromosomeChromosome/Scaffold: 5 Start: 20728485 End: 20731345
Descriptionglycosyl hydrolase 9C1
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CBM495336127.8e-29
  IKFLHSITSTWTIAKTSYYRHKVVLKNTSEKPITNMKLVLENLEGPLWGLSPTPQKNTYELPQWQKVLQPGAECTFVYVQ
GH9324920
  NYGEALDKSLLFFEAQRSGKLPPNQRVKWRGDSGLKDGLAQGVDLVGGYYDAGDHVKFGLPMAFTVTMLSWGAIEFRKEITDLDQLGQTLWAIRWGTDYF
  IKAHPQPNVLWGQVGDGNSDHYCWERAEDMTTPRNAYKIDESHPGSDIAGETAAALASAAMAFKPYNSSYSSLLLVHAKQLFSFADRFRGLYDETIEDAK
  EFYTSSGYSDELLWAAAWLYEATNDDYYLKYVVDNAVYMGGTGWSVKEFSWDNKYAGVQILLTKVLLEGRGGAYTSTLKQYQAKADYFACACLQKNDGYN
  VHTTPGGLLYVREWNNLQYVSSASFLLAVYSDYLSAANAKLNCPEGEVQPQEILNFAKSQADYILGKNPKSMSYIVGYGAKYPVHVHHRDASIPSISVLS
  AVVGCVQGFETWYHRTEGNPNVIYGGLVGGPDQNDNFSDDRSNYEGTEPTISGTGPLVGLF
Full Sequence
Protein Sequence     Length: 626     Download
MMFMRSCTKI VLVSLALLVL LGVEAATASE FNYGEALDKS LLFFEAQRSG KLPPNQRVKW    60
RGDSGLKDGL AQGVDLVGGY YDAGDHVKFG LPMAFTVTML SWGAIEFRKE ITDLDQLGQT    120
LWAIRWGTDY FIKAHPQPNV LWGQVGDGNS DHYCWERAED MTTPRNAYKI DESHPGSDIA    180
GETAAALASA AMAFKPYNSS YSSLLLVHAK QLFSFADRFR GLYDETIEDA KEFYTSSGYS    240
DELLWAAAWL YEATNDDYYL KYVVDNAVYM GGTGWSVKEF SWDNKYAGVQ ILLTKVLLEG    300
RGGAYTSTLK QYQAKADYFA CACLQKNDGY NVHTTPGGLL YVREWNNLQY VSSASFLLAV    360
YSDYLSAANA KLNCPEGEVQ PQEILNFAKS QADYILGKNP KSMSYIVGYG AKYPVHVHHR    420
DASIPSISVL SAVVGCVQGF ETWYHRTEGN PNVIYGGLVG GPDQNDNFSD DRSNYEGTEP    480
TISGTGPLVG LFSKLQSLNG GFNRGSPKPH TPTPSVYHNE TTAPPKPADT HPIKFLHSIT    540
STWTIAKTSY YRHKVVLKNT SEKPITNMKL VLENLEGPLW GLSPTPQKNT YELPQWQKVL    600
QPGAECTFVY VQGGPQAKIS IQSYN*                                         660
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02340PLN02340031625598+
PLN02171PLN02171032624600+
PLN02420PLN02420031500472+
PLN00119PLN00119032495464+
pfam00759Glyco_hydro_9032493464+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005576extracellular region
GO:0005975carbohydrate metabolic process
GO:0030246carbohydrate binding
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1ksd_A0314793412A Chain A, Crystal Structure Of The Nasturtium Seedling Xyloglucanase Isoform Nxg1
PDB1ksc_A0314793412A Chain A, Crystal Structure Of The Nasturtium Seedling Xyloglucanase Isoform Nxg1
PDB1ks8_A0314793412A Chain A, The Structure Of Endoglucanase From Termite, Nasutitermes Takasagoensis, At Ph 2.5.
PDB4tf4_B0314794424A Chain A, The Structure Of Endoglucanase From Termite, Nasutitermes Takasagoensis, At Ph 2.5.
PDB4tf4_A0314794424A Chain A, The Structure Of Endoglucanase From Termite, Nasutitermes Takasagoensis, At Ph 2.5.
Transmembrane Domains
StartEnd
1234
Signal Peptide
Cleavage Site
28
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_002_01464.1.518.596Aquca_037_00141.1.542.619Aquca_013_00114.1.534.611
Arabidopsis lyrata474038.535.614489943.534.611892975.528.605
Arabidopsis thalianaAT1G64390.1.528.605AT1G48930.1.535.614AT4G11050.1.534.611
Brachypodium distachyonBradi2g32270.1.538.616Bradi2g07150.1.534.613
Brassica rapaBra032270.517.596Bra000732.268.345Bra027699.529.606Bra018765.532.611Bra027735.528.605
Carica papayaevm.model.supercontig_183.4.367.446evm.TU.contig_27379.2.529.606
Capsella rubellaCarubv10012624m.534.613Carubv10003874m.535.612Carubv10019981m.528.605
Citrus clementinaCiclev10019301m.537.614Ciclev10033912m.569.648
Citrus sinensisorange1.1g043219m.499.578orange1.1g019436m.249.326orange1.1g017562m.277.354orange1.1g011712m.387.464orange1.1g006835m.537.614
Cucumis sativusCucsa.107370.1.527.604Cucsa.128330.1.503.582Cucsa.303850.1.533.608
Eucalyptus grandisEucgr.D01733.1.529.606Eucgr.J00862.1.484.562Eucgr.E00858.1.526.602Eucgr.D01896.1
Fragaria vescamrna32087.1-v1.0-hybrid.632.709mrna11058.1-v1.0-hybrid.533.612
Glycine maxGlyma12g03050.1.537.616Glyma05g36930.1.532.609Glyma08g02610.1.533.610Glyma11g10760.1.535.614
Gossypium raimondiiGorai.003G080800.1.533.609Gorai.008G254000.1.534.611Gorai.004G133700.1.536.613Gorai.005G210200.1.530.608
Linum usitatissimumLus10003888.529.606Lus10010201.535.613Lus10032377.534.611Lus10017402.508.586Lus10001833.527.603
Lus10033956
Malus domesticaMDP0000276676.536.613MDP0000131267.528.605MDP0000548943MDP0000722052.313.390MDP0000826600.538.616
Manihot esculentacassava4.1_004404m.486.565cassava4.1_003698m.530.607
Medicago truncatulaMedtr4g074960.1.571.649
Mimulus guttatusmgv1a003302m.501.580
Oryza sativaLOC_Os01g12070.1.544.625LOC_Os01g12030.1.543.620LOC_Os04g57860.1.531.610LOC_Os05g12150.1.535.613
Panicum virgatumPavirv00000152m.548.625Pavirv00066185m.348.426Pavirv00000772m.535.612Pavirv00030375m.537.614Pavirv00029375m.528.607
Physcomitrella patensPp1s176_127V6.1.544.623
Phaseolus vulgarisPhvul.011G030300.1.567.645Phvul.002G297600.1.530.607
Picea abiesMA_895058g0010MA_10437098g0010.516.596MA_127108g0010.524.603MA_42717g0010.527.604MA_10241783g0010.543.621
MA_19509g0020.547.626
Populus trichocarpaPotri.003G139600.1.530.607Potri.001G092200.1.530.607Potri.001G092200.5.285.362Potri.007G071200.1.520.599Potri.007G071200.2.519.598
Potri.001G092200.4.375.452
Prunus persicappa002939m.528.605ppa022524m.499.578
Ricinus communis29675.m000388.528.607
Setaria italicaSi000642m.549.626Si021474m.530.607Si021476m.528.606
Selaginella moellendorffii234652.525.60399802.550.630
Sorghum bicolorSb09g006670.1.535.612Sb03g001560.1.561.639Sb06g032760.1.534.615
Thellungiella halophilaThhalv10023353m.527.604Thhalv10011318m.534.613Thhalv10028514m.535.612
Vitis viniferaGSVIVT01019523001.537.614GSVIVT01012043001.524.602
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)