y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna11297.1-v1.0-hybrid
FamilyGT21
Protein PropertiesLength: 500 Molecular Weight: 56264.1 Isoelectric Point: 7.7412
ChromosomeChromosome/Scaffold: 1 Start: 4219868 End: 4223841
DescriptionNucleotide-diphospho-sugar transferases superfamily protein
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT21862224.7e-28
  PRVSVVMPLKGFGEHNLHNWRSQITSLYGGPLEFIFVVESTEDPAYRAVSMLTSELKEEVDAKIIVAGLSTTCSQKIHNQLVGVDKMHKDSKYVLFLDDD
  VRLHPGSIGALTTEMEKNPDIFIQTGYPLDLPSGSLG
Full Sequence
Protein Sequence     Length: 500     Download
MSTTEMDPLD SLLFSLSKTL CSPFAVFLQL QGCSICLLLA LGWACAAYVR NREIKRMKDS    60
MQRGNSFAFL CQDIMELEHS NQVNLPRVSV VMPLKGFGEH NLHNWRSQIT SLYGGPLEFI    120
FVVESTEDPA YRAVSMLTSE LKEEVDAKII VAGLSTTCSQ KIHNQLVGVD KMHKDSKYVL    180
FLDDDVRLHP GSIGALTTEM EKNPDIFIQT GYPLDLPSGS LGSYCIYEYH MMHADDFRLD    240
RYGVVSGLRD GGYSDDMTLA AISGAHKRLI TSPPVAVFPH PLASDLSFSR YWNYLRKQTF    300
VLESYLTKVN WIMNRALFTV HCYLSWGFVT PYLMAIVHVT AALRMYIKGY SVEETTFTFG    360
GLTLVGCLAV CTIVELLSMW NLTRIEVHLC NMLSPEAPNL SLATYNWALV FIALVVDNFL    420
YPISAFRSHF TQSINWSGIR YHLKNGKIFK IERSKDMGPT YTDLGGKHLG KKGAPPKLSF    480
LSSLARSLAQ WYQPKKYES*                                                540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
TIGR03472HpnI0.000686210128+
cd04186GT_2_like_c9.0e-517520632+
pfam13506Glyco_transf_213.0e-6144296177+
COG1215COG12151.0e-681347293+
cd02520Glucosylceramide_synthase6.0e-1086296216+
Transmembrane Domains
StartEnd
2749
320342
357379
399421
Hydropathy
Orthologous Group
SpeciesID
Arabidopsis lyrata319569
Arabidopsis thalianaAT2G19880.1AT2G19880.2
Brachypodium distachyonBradi2g58060.1
Brassica rapaBra036698Bra039028Bra031106
Carica papayaevm.model.supercontig_40.95
Capsella rubellaCarubv10013384m
Citrus clementinaCiclev10008006m
Citrus sinensisorange1.1g010062m
Cucumis sativusCucsa.288830.1
Eucalyptus grandisEucgr.C03729.1
Glycine maxGlyma08g03760.1Glyma01g01130.1Glyma05g35860.2Glyma16g08510.1
Gossypium raimondiiGorai.010G077100.1Gorai.010G077100.2Gorai.009G027500.1Gorai.009G027500.2
Linum usitatissimumLus10034973
Malus domesticaMDP0000289917MDP0000035240MDP0000126193
Manihot esculentacassava4.1_005602mcassava4.1_007721m
Medicago truncatulaMedtr8g102490.1Medtr8g102500.1
Mimulus guttatusmgv1a004497mmgv1a004580m
Oryza sativaLOC_Os01g67870.1
Panicum virgatumPavirv00019095mPavirv00063321m
Physcomitrella patensPp1s194_131V6.1
Phaseolus vulgarisPhvul.004G176200.1Phvul.002G308700.1
Populus trichocarpaPotri.018G087700.3Potri.018G087700.2Potri.018G087700.1Potri.006G164800.2Potri.T063300.1
Potri.006G164800.1
Prunus persicappa004285mppa005382m
Ricinus communis29912.m005431
Setaria italicaSi001058m
Selaginella moellendorffii74622
Sorghum bicolorSb03g043150.1
Thellungiella halophilaThhalv10001962m
Vitis viniferaGSVIVT01015303001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny