y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna11513.1-v1.0-hybrid
FamilyAA3
Protein PropertiesLength: 766 Molecular Weight: 83512.6 Isoelectric Point: 7.6827
ChromosomeChromosome/Scaffold: 4 Start: 3358395 End: 3364261
Descriptionfatty alcohol oxidase 3
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA32287550
  DKGLKVTHDSKNNLYKIKCDVVIVGSGCGGGVAAAVLASSGQKVIVLEKGNYFTASDYSSLEGPSQDQLYESGGILATFDGKVMLQAGSTVGGGSAVNWS
  ACIRPPDSLLQEWAKDQKIAFFGGSEYVSAMNAVWERIGVTESCVEEGFQNQVLRKGCETLGLDVHFTPRNSSEKHYCGSCGYGCKKGEKKGTDTTWLVD
  AVDHGAVILSGCKAERFVLAKSYKSGSMRKKKCLGVVAKSLSNNITKRLQIEAKVTISACGALLTPPLMISSGLKNRHIGRNLHLHPVLMAWGYFPDSIN
  SEFKGKSYKGGIITSVHEVVSEDSKPRAIIETPALGPGSFAALCPWESGLDMKKRMLRFSRTAHLITIIRDKGSGVIRTEGRASYELDVSDKENMKAGMR
  QALRILIAAGAVEVGTHRSDGLRLKCEGIDKEGLEEFLDKVSAEEGPQSLVEKWTPYSSAHQMGSCRMGINEKEGAVDQNGESWEAEGLFVCDGSVLPSA
  VGVNPMITIESTAYYLSKRLAESLRNQK
Full Sequence
Protein Sequence     Length: 766     Download
MRKECHPLLR GGSKGGGEDG KVYRHRLSSG EMEALASVCE ALLPPLPFGD PASYYEGKNE    60
ELSGTKAVQS FYQASGAQSG IPDEVADLLV KRAFTEAIIL VRVVLWILST RLGSLLLCGS    120
LCLGDKWPFI HKFSCLPLEK RERVLQWWFR HWFLTPIRLA FLYIKILCVF TFFSRVDENA    180
ENPAWKAIGY EVEPAANPEK VPEERSLHKG IIETMYQTDT SLLDSLADKG LKVTHDSKNN    240
LYKIKCDVVI VGSGCGGGVA AAVLASSGQK VIVLEKGNYF TASDYSSLEG PSQDQLYESG    300
GILATFDGKV MLQAGSTVGG GSAVNWSACI RPPDSLLQEW AKDQKIAFFG GSEYVSAMNA    360
VWERIGVTES CVEEGFQNQV LRKGCETLGL DVHFTPRNSS EKHYCGSCGY GCKKGEKKGT    420
DTTWLVDAVD HGAVILSGCK AERFVLAKSY KSGSMRKKKC LGVVAKSLSN NITKRLQIEA    480
KVTISACGAL LTPPLMISSG LKNRHIGRNL HLHPVLMAWG YFPDSINSEF KGKSYKGGII    540
TSVHEVVSED SKPRAIIETP ALGPGSFAAL CPWESGLDMK KRMLRFSRTA HLITIIRDKG    600
SGVIRTEGRA SYELDVSDKE NMKAGMRQAL RILIAAGAVE VGTHRSDGLR LKCEGIDKEG    660
LEEFLDKVSA EEGPQSLVEK WTPYSSAHQM GSCRMGINEK EGAVDQNGES WEAEGLFVCD    720
GSVLPSAVGV NPMITIESTA YYLSKRLAES LRNQKSSNVG VDFFS*                   780
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
TIGR02462pyranose_ox0.00667475380+
TIGR03970Rv06970.0009612752142+
pfam05199GMC_oxred_C5.0e-19618743126+
COG2303BetA6.0e-21315753491+
pfam00732GMC_oxred_N5.0e-73294515225+
Gene Ontology
GO TermDescription
GO:0009055electron carrier activity
GO:0016491oxidoreductase activity
GO:0016614oxidoreductase activity, acting on CH-OH group of donors
GO:0050660flavin adenine dinucleotide binding
GO:0055114oxidation-reduction process
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3ljp_B0.0007434756225531A Chain A, Crystal Structure Of Choline Oxidase V464a Mutant
PDB3ljp_A0.0007434756225531A Chain A, Crystal Structure Of Choline Oxidase V464a Mutant
PDB3nne_H0.001434756225531A Chain A, Crystal Structure Of Choline Oxidase S101a Mutant
PDB3nne_G0.001434756225531A Chain A, Crystal Structure Of Choline Oxidase S101a Mutant
PDB3nne_F0.001434756225531A Chain A, Crystal Structure Of Choline Oxidase S101a Mutant
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_089_00009.1Aquca_049_00132.1Aquca_034_00307.1Aquca_034_00304.1
Arabidopsis lyrata914728491906479855470376
Arabidopsis thalianaAT4G19380.1AT4G28570.1AT3G23410.1AT1G03990.1
Brachypodium distachyonBradi3g28677.1Bradi3g28657.1Bradi3g49085.1
Brassica rapaBra012548Bra024190Bra013391Bra015283Bra001912
Bra014947
Carica papayaevm.model.supercontig_165.33evm.model.supercontig_44.31evm.model.supercontig_2124.1
Capsella rubellaCarubv10004418mCarubv10004208mCarubv10012453mCarubv10004212mCarubv10013046m
Citrus clementinaCiclev10011111mCiclev10004403mCiclev10004405mCiclev10018992m
Citrus sinensisorange1.1g003990morange1.1g004496m
Cucumis sativusCucsa.037200.2Cucsa.037200.1Cucsa.035240.1Cucsa.255570.1
Eucalyptus grandisEucgr.H03017.2Eucgr.H03017.1Eucgr.H00753.1Eucgr.K02114.1Eucgr.D02566.1
Eucgr.D02568.1
Fragaria vescamrna08288.1-v1.0-hybridmrna08285.1-v1.0-hybrid
Glycine maxGlyma09g35210.2Glyma01g35620.1Glyma16g16415.1Glyma16g08300.2Glyma10g32640.2
Glyma12g15940.1Glyma19g34960.1Glyma06g42400.2Glyma03g32220.2
Gossypium raimondiiGorai.001G179800.3Gorai.001G179800.2Gorai.001G179800.1Gorai.011G177100.3Gorai.011G177100.2
Gorai.011G177100.1Gorai.006G252500.1
Linum usitatissimumLus10003621Lus10024922Lus10035673Lus10008239Lus10022903
Lus10037257Lus10011800
Malus domesticaMDP0000233110MDP0000173300MDP0000208936MDP0000197715
Manihot esculentacassava4.1_004067mcassava4.1_002349mcassava4.1_002619mcassava4.1_002379mcassava4.1_025870m
Medicago truncatulaMedtr5g025650.1Medtr8g072210.1Medtr4g081080.1Medtr1g075650.1Medtr4g080890.1
Mimulus guttatusmgv1a001761mmgv1a022390mmgv1a001868mmgv1a001883mmgv1a001896m
Oryza sativaLOC_Os10g33540.1LOC_Os10g33520.1LOC_Os10g33460.1LOC_Os02g40840.1
Panicum virgatumPavirv00054947m
Physcomitrella patensPp1s58_61V6.1Pp1s7_216V6.1Pp1s48_250V6.1Pp1s2_413V6.1
Phaseolus vulgarisPhvul.002G122600.1Phvul.003G278200.1Phvul.007G124200.1Phvul.001G162800.1Phvul.011G136600.1
Picea abiesMA_10427118g0010MA_9032943g0010MA_9483g0010MA_10427421g0010MA_242814g0010
Populus trichocarpaPotri.004G234900.2Potri.004G234900.1Potri.010G069100.1Potri.008G169300.1Potri.002G259700.1
Prunus persicappa014756mppa018458mppa021498m
Ricinus communis29827.m00265529981.m00058628492.m000467
Setaria italicaSi034362mSi034354mSi034359mSi016380m
Selaginella moellendorffii1140891168557460173531
Sorghum bicolorSb01g019470.1Sb01g019460.1Sb01g019480.1Sb04g026370.1Sb04g026390.1
Thellungiella halophilaThhalv10024717mThhalv10024496mThhalv10024528mThhalv10020141mThhalv10006882m
Vitis viniferaGSVIVT01036891001GSVIVT01027855001GSVIVT01028371001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)