y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna11624.1-v1.0-hybrid
FamilyCBM57
Protein PropertiesLength: 849 Molecular Weight: 93736.8 Isoelectric Point: 6.3583
ChromosomeChromosome/Scaffold: Start: 9274779 End: 9280831
DescriptionLeucine-rich repeat transmembrane protein kinase
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CBM576027715.5e-31
  SIKCGGTSQKSVSGIKYDDDSEILGAASTYKSSRNQWAVSNTGNFLFNSNGPQYIASTDSQIKGTLESELYKTARISPTSLRYYGLDLKNGKYVVELHFA
  ELQMEDTASWKGLGRRLFDVYIQGERVVQDLNIQKEAGGSKKALIKKFETNVSNTIMDIHFLWAGKGTCC
Full Sequence
Protein Sequence     Length: 849     Download
MELQLGLALS LPVHHNAPVK GFDVTGRHGV MRSLDIWSYG CSMERKKKRI FDTAFEDDDE    60
SKTLPLLLWH GQPGEEDDDG KRQKKRDFCS FIDAKDGEGD QVVGWPPIKS WRKKMLFSDH    120
DQHHGHGHAH HNFQNHQNLV EKEDDGSENS MYVKVKMEGV GILRKIDIKL HHSYQTLRDS    180
LITMFAKCKE CENEDTADFT VTYQDMHGHW LLAGDVPWHL LLVLKETVKA EKQGTVLMTL    240
LLQMELWSAL SLLLLCAFQL VYAQRTTAPD EVTALNKVLE HWNLANHLNL TIDPCTENAT    300
WASETANPRV ACDCTGSTCH ITHLKIYALD IVGDLPGELF ELKQLIDLNL GQNVLSGRIP    360
PEIGLLSNMQ YLSLGINNLS GPVPPELGKL TKLVELSFSS NEFSGPLPVE LGKLTSLQQL    420
YIDSSGVTGP IPQEFSSLKS LQTLRLEGTL LEGPIPSNFG ALTKLDILRI GDLSKEDSSL    480
DFLENLTSLS MLSLRSCQVS GKIPEQIGKF SKLQYLYLGN NDLSGELPTS IVSPKLIALD    540
VSFNPISGNL PSNFSTEGFS LNVLGTSINA KGLSDSGEPG LLHCLQGDTK CTNKLPAVSS    600
FSIKCGGTSQ KSVSGIKYDD DSEILGAAST YKSSRNQWAV SNTGNFLFNS NGPQYIASTD    660
SQIKGTLESE LYKTARISPT SLRYYGLDLK NGKYVVELHF AELQMEDTAS WKGLGRRLFD    720
VYIQGERVVQ DLNIQKEAGG SKKALIKKFE TNVSNTIMDI HFLWAGKGTC CIPYQGTYGP    780
LVSAIHVHQV SGAESSSSSE RKRVGTIVGV SLGCAAVMII MSSVFYLWWI KDDAEPRHVR    840
 IDGRVRKT*                                                           900
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN00113PLN001131.0e-25293554268+
PLN00113PLN001132.0e-27333555250+
PLN00113PLN001134.0e-29316556243+
PLN00113PLN001131.0e-34326558239+
pfam11721Malectin3.0e-55600785188+
Gene Ontology
GO TermDescription
GO:0005515protein binding
GO:0005634nucleus
GO:0006355regulation of transcription, DNA-dependent
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3rj0_A3e-19330552351553A Chain A, Structure Function Studies Of Vaccinia Virus Host-Range Protein K1 Reveal A Novel Ankyrin Repeat Interaction Surface For K1s Function
PDB3rj0_A6e-16316556436699A Chain A, Structure Function Studies Of Vaccinia Virus Host-Range Protein K1 Reveal A Novel Ankyrin Repeat Interaction Surface For K1s Function
PDB3rj0_A0.000000000000006320556176437A Chain A, Structure Function Studies Of Vaccinia Virus Host-Range Protein K1 Reveal A Novel Ankyrin Repeat Interaction Surface For K1s Function
PDB3rj0_A0.00000000000009345531393555A Chain A, Structure Function Studies Of Vaccinia Virus Host-Range Protein K1 Reveal A Novel Ankyrin Repeat Interaction Surface For K1s Function
PDB3rj0_A0.0000000000001330528474718A Chain A, Structure Function Studies Of Vaccinia Virus Host-Range Protein K1 Reveal A Novel Ankyrin Repeat Interaction Surface For K1s Function
Transmembrane Domains
StartEnd
808830
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_030_00368.2Aquca_030_00368.1
Arabidopsis lyrata883240.424.594883240.424.594892639892640892638
Arabidopsis thalianaAT1G56130.1AT1G56140.1AT1G56120.1AT1G56145.2AT1G56145.1
Brachypodium distachyonBradi5g21870.2Bradi5g21857.1Bradi3g17756.2Bradi3g17756.1Bradi1g48230.1
Brassica rapaBra003333Bra007909Bra007908Bra030813Bra030815
Bra033670Bra035966Bra033958Bra007907Bra016226
Carica papayaevm.model.supercontig_2207.1evm.model.supercontig_748.4
Capsella rubellaCarubv10008172mCarubv10012587mCarubv10010895mCarubv10008256mCarubv10008071m.409.563
Carubv10008071m.409.563Carubv10008183m
Citrus clementinaCiclev10007054mCiclev10007687mCiclev10007686mCiclev10018029mCiclev10018038m
Ciclev10014641mCiclev10014117m
Citrus sinensisorange1.1g001658morange1.1g008072morange1.1g006515morange1.1g006206morange1.1g004413m
orange1.1g002562morange1.1g002581morange1.1g038019m
Cucumis sativusCucsa.239700.2Cucsa.239700.1
Eucalyptus grandisEucgr.F04434.2Eucgr.F04434.1Eucgr.F04306.1Eucgr.F04441.1Eucgr.F02391.1
Eucgr.F04436.1Eucgr.C02767.1Eucgr.L01594.1Eucgr.F04301.1Eucgr.L01787.1
Eucgr.B01468.1Eucgr.F04437.1
Fragaria vescamrna16334.1-v1.0-hybridmrna30033.1-v1.0-hybridmrna28048.1-v1.0-hybrid
Glycine maxGlyma09g15200.3Glyma09g15200.2Glyma09g15200.1Glyma08g25590.2Glyma08g25600.2
Glyma08g25600.1
Gossypium raimondiiGorai.002G105800.1Gorai.001G034000.1Gorai.011G052100.1Gorai.N011200.1Gorai.011G052400.2
Gorai.011G052400.1Gorai.001G131900.1Gorai.006G091400.1Gorai.011G052300.5Gorai.011G052300.4
Gorai.011G052300.3Gorai.011G052300.2Gorai.011G052300.1Gorai.011G052000.1Gorai.011G052600.8
Gorai.011G052600.7Gorai.011G052600.6Gorai.011G052600.5Gorai.011G052600.4Gorai.011G052600.3
Gorai.011G052600.2Gorai.011G052600.1
Linum usitatissimumLus10031199
Malus domesticaMDP0000210289MDP0000183693.203.372MDP0000183693.203.372MDP0000213902MDP0000251746
MDP0000269684MDP0000267728MDP0000281046MDP0000207688MDP0000183693.772.939
MDP0000183693.772.939MDP0000389758MDP0000278907MDP0000306337MDP0000384033
MDP0000171164MDP0000307776MDP0000212717MDP0000311945MDP0000308237
MDP0000283397MDP0000122720
Manihot esculentacassava4.1_001509mcassava4.1_001407mcassava4.1_025733mcassava4.1_030674m
Mimulus guttatusmgv1a002601mmgv1a018669mmgv1a000612m
Oryza sativaLOC_Os04g22470.1LOC_Os08g10300.1LOC_Os08g10290.1LOC_Os04g52640.3LOC_Os04g52640.2
LOC_Os04g52640.1LOC_Os04g52600.1LOC_Os04g52630.1LOC_Os05g17810.1LOC_Os04g52614.1
LOC_Os08g10330.1LOC_Os05g17604.6LOC_Os05g17604.5LOC_Os05g17604.4LOC_Os05g17604.3
LOC_Os05g17604.2LOC_Os05g17604.1LOC_Os05g16430.1LOC_Os08g10320.3LOC_Os08g10320.2
LOC_Os08g10320.1LOC_Os08g10310.3LOC_Os08g10310.2LOC_Os08g10310.1LOC_Os04g52606.1
LOC_Os05g16930.1LOC_Os06g07130.1LOC_Os04g52590.1LOC_Os08g10250.1LOC_Os05g16824.4
LOC_Os05g16824.3LOC_Os05g16824.2LOC_Os05g16824.1LOC_Os05g16740.1
Panicum virgatumPavirv00010367mPavirv00021132mPavirv00063388mPavirv00039446mPavirv00006527m
Pavirv00041471mPavirv00039639mPavirv00031150mPavirv00014784mPavirv00036213m
Pavirv00070332mPavirv00032467mPavirv00022623mPavirv00048042m
Physcomitrella patensPp1s244_27V6.2
Phaseolus vulgarisPhvul.011G169300.1
Picea abiesMA_170647g0010MA_162469g0010MA_73800g0010MA_8849269g0010MA_18275g0010
MA_17053g0010MA_954053g0010MA_54077g0010MA_10436782g0010MA_404302g0010
MA_461914g0010
Populus trichocarpaPotri.006G255100.2Potri.018G026800.2Potri.018G026800.1Potri.006G255100.1Potri.001G082900.5
Potri.001G082900.4Potri.001G082900.3Potri.001G082900.2Potri.001G082900.1Potri.003G148000.3
Potri.003G148000.2Potri.003G148000.1Potri.007G067900.3Potri.007G067900.2Potri.007G067900.1
Prunus persicappa017326mppa017049mppa001211mppa001152mppa000802m
ppa015982mppa026535m
Ricinus communis29848.m00461730169.m00632829497.m00008929624.m000325
Setaria italicaSi013203mSi013191mSi013178mSi009240mSi012655m
Si009468mSi009463mSi009322mSi028769mSi028790m
Si009325mSi009466mSi009259mSi006097m
Selaginella moellendorffii438852
Sorghum bicolorSb07g005820.1Sb06g028570.1Sb06g028560.1Sb10g004730.1
Thellungiella halophilaThhalv10012006mThhalv10018064mThhalv10011215mThhalv10016280mThhalv10016175m
Thhalv10019658mThhalv10012222m
Vitis viniferaGSVIVT01037993001.434.602GSVIVT01037993001.434.602GSVIVT01035865001GSVIVT01013621001GSVIVT01029720001.503.674
GSVIVT01029720001.503.674GSVIVT01037982001GSVIVT01038011001GSVIVT01013608001GSVIVT01013612001
GSVIVT01029718001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)