y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna11732.1-v1.0-hybrid
FamilyAA2
Protein PropertiesLength: 173 Molecular Weight: 18226.8 Isoelectric Point: 7.2445
ChromosomeChromosome/Scaffold: Start: 9893779 End: 9894558
DescriptionPeroxidase superfamily protein
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA2411481.9e-29
  LTSVRGYGVIDNAKAAVEKLCPGVVSCADIVAVAATDASVAVEGPNWAMKLGRRDSTTASKTLAESSLPSFLDSLESLTNRFAGLGVNVRDLVALSGAHS
  ISNSANQI
Full Sequence
Protein Sequence     Length: 173     Download
MTATLEACKG DQPFMSFAVS YSTRYCYNHR RKECTATLRN LTSVRGYGVI DNAKAAVEKL    60
CPGVVSCADI VAVAATDASV AVEGPNWAMK LGRRDSTTAS KTLAESSLPS FLDSLESLTN    120
RFAGLGVNVR DLVALSGAHS ISNSANQIFI MDLASGFGAL LIYTISEPIF SG*           180
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd00314plant_peroxidase_like0.00018414161+
cd00691ascorbate_peroxidase7.0e-78414158+
PLN03030PLN030309.0e-2144149108+
pfam00141peroxidase1.0e-2440141102+
cd00693secretory_peroxidase3.0e-304314199+
Gene Ontology
GO TermDescription
GO:0004601peroxidase activity
GO:0006979response to oxidative stress
GO:0020037heme binding
GO:0055114oxidation-reduction process
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1qo4_A3e-284014171172A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants
PDB1pa2_A3e-284014171172A Chain A, Arabidopsis Thaliana Peroxidase A2
PDB1sch_B7e-284014170171A Chain A, Peanut Peroxidase
PDB1sch_A7e-284014170171A Chain A, Peanut Peroxidase
PDB4a5g_B2e-274014972181A Chain A, Raphanus Sativus Anionic Peroxidase.
Hydropathy