y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna11817.1-v1.0-hybrid
FamilyGT57
Protein PropertiesLength: 376 Molecular Weight: 41811.7 Isoelectric Point: 8.8302
ChromosomeChromosome/Scaffold: 5 Start: 21547471 End: 21549827
DescriptionALG6, ALG8 glycosyltransferase family
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT57442360
  LLVRVAVSLHPYSGAATPPKFGDFEAQRHWMEITLNLPVKEWYRNTTLNDLSYWGLDYPPLTAYQSYVHGLFVRFFSPESVALTTSRGHESYLGKLLMRW
  TVLSSDALVFFPAVFYFIVVYYSGRKQSGSMGGIAWHIAIILLNPCLILIDHGHFQYNCISLGLTVGAISAILSDKDLLACVLYSLALNHKQN
Full Sequence
Protein Sequence     Length: 376     Download
MDKSSKKKVK ISNQEENGES DDAWWWLVHK GITASFLCIA LFSLLVRVAV SLHPYSGAAT    60
PPKFGDFEAQ RHWMEITLNL PVKEWYRNTT LNDLSYWGLD YPPLTAYQSY VHGLFVRFFS    120
PESVALTTSR GHESYLGKLL MRWTVLSSDA LVFFPAVFYF IVVYYSGRKQ SGSMGGIAWH    180
IAIILLNPCL ILIDHGHFQY NCISLGLTVG AISAILSDKD LLACVLYSLA LNHKQNGGYL    240
VEGLIWGEKM EECSVAGIKT QVGRVGEWAK IMRRGVGICT CLSEGTLGGG VPVVVKVERR    300
LEGWKKALLG SGIRILLVQI GESESCLWEN LLSKAFSQST ASVFWNAKVP PKNRLFQEAM    360
LSWAIAANYM ALLKK*                                                    420
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam03155Alg6_Alg82.0e-6343235194+
Gene Ontology
GO TermDescription
GO:0005789endoplasmic reticulum membrane
GO:0016758transferase activity, transferring hexosyl groups
Transmembrane Domains
StartEnd
2446
144166
176193
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_007_00849.3Aquca_007_00849.4Aquca_007_00849.2Aquca_007_00849.1
Arabidopsis lyrata494131
Arabidopsis thalianaAT5G38460.2AT5G38460.1
Brachypodium distachyonBradi1g63540.1
Brassica rapaBra028183
Capsella rubellaCarubv10004565m
Chlamydomonas reinhardtiiCre16.g690150.t1.2.24.157Cre16.g690150.t1.2.206.572Cre16.g690150.t1.2.24.157Cre16.g690150.t1.2.206.572
Citrus clementinaCiclev10011466mCiclev10011636mCiclev10012149m
Citrus sinensisorange1.1g021456m
Cucumis sativusCucsa.031380.1
Eucalyptus grandisEucgr.F02485.1Eucgr.F02485.2.50.327Eucgr.F02485.2.50.327Eucgr.F02485.2.327.474Eucgr.F02485.2.327.474
Glycine maxGlyma13g07560.1
Gossypium raimondiiGorai.006G229700.2Gorai.006G229700.1
Linum usitatissimumLus10017594Lus10033554
Malus domesticaMDP0000909996MDP0000278459MDP0000180745MDP0000308736
Manihot esculentacassava4.1_009619mcassava4.1_005541m
Mimulus guttatusmgv1a004432m
Oryza sativaLOC_Os07g07010.1
Panicum virgatumPavirv00049296mPavirv00013587mPavirv00013588m
Physcomitrella patensPp1s290_38V6.3Pp1s290_38V6.2Pp1s290_38V6.1
Phaseolus vulgarisPhvul.004G064500.1Phvul.002G243400.1Phvul.002G243400.2
Picea abiesMA_111087g0010
Populus trichocarpaPotri.017G114100.2Potri.004G100500.1Potri.017G114100.1
Prunus persicappa004184m
Ricinus communis30205.m001578
Setaria italicaSi036186mSi035197m
Selaginella moellendorffii114109
Sorghum bicolorSb01g036460.2.41.351Sb01g036460.2.41.351Sb01g036460.1Sb01g036460.2.352.477Sb01g036460.2.352.477
Thellungiella halophilaThhalv10017711mThhalv10027717m
Vitis viniferaGSVIVT01031043001
Volvox carteriVocar20001407m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny