y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna11885.1-v1.0-hybrid
FamilyGT66
Protein PropertiesLength: 841 Molecular Weight: 93391.5 Isoelectric Point: 9.4571
ChromosomeChromosome/Scaffold: 5 Start: 21900856 End: 21908985
Descriptionstaurosporin and temperature sensitive 3-like A
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT66847830
  AFLILILIGVLAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWLLNSLNIPLSVETICVF
  TAPIFSAFTSWSTYLLTREVKGTGAGLTAAALIAMVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYATLNSLAYFYMVCSWGGYTFIINL
  IPMHVLMCIVTGRYSSRLYIAYAPLVVLGTLLAALVPVVGFNAVMTSEHFASFLVFIIIHVVAFVYYIKGVLSPKMFKVAVTLVLSIGLVVCCAVIAVLV
  ALVASSPTKGWSGRSLSLLDPTYASKYIPIIASVSEHQPPTWPSYFMDINVLAFLVPAGIIACFSPLSDASSFVILYIVTSVYFSGVMVRLMLVLAPAAC
  ITSGIALSEAFEVFTRSIKFQLPGLPGLSPVEAEETSTDSTVPLNEVPKTDKGGETLKERPSRKNRKKEKEPVEKPSIKARIEKKLLVLPFEGSILAIFL
  LVLLGAFYVVHCVWAAAEAYSAPSIVLTSHSHDGLHVFDDFREAYAWLSHNTEVDDKVASWWDYGYQTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEK
  AAWEIFNSLDVKYVLVVFGGLVGYPSDDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDNQATPTMLNCLMYKLSYYRFVDTDGKGFDRVRRTEIGKKY
Full Sequence
Protein Sequence     Length: 841     Download
MAEGFWSAGT SPEVSRKSCR RSAGNFAGNL AGGPLEISPE VRRRLFRNES VVSAILSRSL    60
RSSMEASETS SGKTLRNAFG NVLAFLILIL IGVLAFSIRL FSVIKYESVI HEFDPYFNYR    120
VTQFLTKNGI YDFWNWFDDR TWYPLGRVIG GTVYPGLTLT AGTLWWLLNS LNIPLSVETI    180
CVFTAPIFSA FTSWSTYLLT REVKGTGAGL TAAALIAMVP SYISRSVAGS YDNEAVAIFA    240
LIFTFYLYIK TLNTGSLFYA TLNSLAYFYM VCSWGGYTFI INLIPMHVLM CIVTGRYSSR    300
LYIAYAPLVV LGTLLAALVP VVGFNAVMTS EHFASFLVFI IIHVVAFVYY IKGVLSPKMF    360
KVAVTLVLSI GLVVCCAVIA VLVALVASSP TKGWSGRSLS LLDPTYASKY IPIIASVSEH    420
QPPTWPSYFM DINVLAFLVP AGIIACFSPL SDASSFVILY IVTSVYFSGV MVRLMLVLAP    480
AACITSGIAL SEAFEVFTRS IKFQLPGLPG LSPVEAEETS TDSTVPLNEV PKTDKGGETL    540
KERPSRKNRK KEKEPVEKPS IKARIEKKLL VLPFEGSILA IFLLVLLGAF YVVHCVWAAA    600
EAYSAPSIVL TSHSHDGLHV FDDFREAYAW LSHNTEVDDK VASWWDYGYQ TTAMANRTVI    660
VDNNTWNNTH IATVGTAMSS PEKAAWEIFN SLDVKYVLVV FGGLVGYPSD DINKFLWMVR    720
IGGGVFPHIK EPDYLRDGQY RIDNQATPTM LNCLMYKLSY YRFVDTDGKG FDRVRRTEIG    780
KKYFKLTHFE EVFTTHHWMV RIYKLKPPKN RIRGKTKKSK SKSTSTSSGK SSGTRKNPWN    840
*                                                                    900
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
TIGR04154archaeo_STT38.0e-1185276216+
COG1287COG12875.0e-5568813786+
pfam02516STT32.0e-10782764704+
Gene Ontology
GO TermDescription
GO:0004576oligosaccharyl transferase activity
GO:0006486protein glycosylation
GO:0016020membrane
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2lgz_A059483820267A Chain A, Solution Structure Of Stt3p
PDB3vu0_C0.000016237396123A Chain A, Crystal Structure Of The C-terminal Globular Domain Of Oligosaccharyltransferase (afaglb-s2, Af_0040, O30195_arcfu) From Archaeoglobus Fulgidus
PDB3vu0_B0.000016237396123A Chain A, Crystal Structure Of The C-terminal Globular Domain Of Oligosaccharyltransferase (afaglb-s2, Af_0040, O30195_arcfu) From Archaeoglobus Fulgidus
PDB3vu0_A0.000016237396123A Chain A, Crystal Structure Of The C-terminal Globular Domain Of Oligosaccharyltransferase (afaglb-s2, Af_0040, O30195_arcfu) From Archaeoglobus Fulgidus
Transmembrane Domains
StartEnd
79101
146168
175197
207229
236258
273295
302324
334351
364386
428450
455477
578600
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_002_01458.1Aquca_001_00320.1
Arabidopsis lyrata891007488863
Arabidopsis thalianaAT1G34130.1AT5G19690.1
Brachypodium distachyonBradi5g26030.1Bradi2g49640.1Bradi2g19510.1
Brassica rapaBra028034Bra006514Bra002255Bra034441
Carica papayaevm.model.supercontig_467.1.248.439evm.model.supercontig_467.1.248.439evm.model.supercontig_40.47
Capsella rubellaCarubv10008402mCarubv10000271m
Chlamydomonas reinhardtiiCre07.g330100.t1.2g9581.t1
Citrus clementinaCiclev10019005mCiclev10019106mCiclev10007574mCiclev10007513mCiclev10007684m
Citrus sinensisorange1.1g004635morange1.1g005395morange1.1g004678morange1.1g003973m
Cucumis sativusCucsa.122250.1Cucsa.122250.2Cucsa.329260.1Cucsa.329260.2
Eucalyptus grandisEucgr.K02314.1Eucgr.C01008.1
Fragaria vescamrna09173.1-v1.0-hybrid
Glycine maxGlyma16g33881.1Glyma09g29470.1Glyma01g01270.1Glyma16g08410.1
Gossypium raimondiiGorai.013G004300.1Gorai.013G004300.2Gorai.011G219600.1Gorai.011G219600.4Gorai.011G219600.3
Gorai.011G219600.2Gorai.011G219600.5Gorai.013G229700.1Gorai.010G075800.1Gorai.010G075800.2
Gorai.010G075800.3
Linum usitatissimumLus10041985Lus10017990Lus10043241Lus10011124
Malus domesticaMDP0000299027MDP0000589608MDP0000158858MDP0000201702MDP0000300736
Manihot esculentacassava4.1_002347mcassava4.1_021540m
Medicago truncatulaMedtr6g077750.1Medtr6g077750.2Medtr1g114250.1
Mimulus guttatusmgv1a001976mmgv1a001650m
Oryza sativaLOC_Os04g57890.1LOC_Os05g44360.1LOC_Os05g44360.2
Panicum virgatumPavirv00017930mPavirv00007453mPavirv00022940mPavirv00024588mPavirv00056880m
Pavirv00065583m
Physcomitrella patensPp1s98_21V6.1Pp1s404_37V6.1Pp1s404_38V6.1
Phaseolus vulgarisPhvul.004G139400.1Phvul.004G170000.1
Picea abiesMA_174842g0010MA_10216317g0010MA_5501292g0010MA_10436134g0010
Populus trichocarpaPotri.012G036300.1Potri.015G028300.1Potri.015G028300.2Potri.018G086000.2Potri.018G086000.1
Potri.006G163600.1
Prunus persicappa001886mppa001464m
Ricinus communis30189.m00167429912.m005461
Setaria italicaSi021341mSi000402mSi021271mSi021321m
Selaginella moellendorffii110405118919
Sorghum bicolorSb06g032800.1Sb09g025920.1Sb03g034385.1
Thellungiella halophilaThhalv10006908mThhalv10012742m
Vitis viniferaGSVIVT01015322001GSVIVT01029339001
Volvox carteriVocar20013212mVocar20003562m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)