y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna12086.1-v1.0-hybrid
FamilyAA1
Protein PropertiesLength: 576 Molecular Weight: 64836.9 Isoelectric Point: 4.8217
ChromosomeChromosome/Scaffold: 5 Start: 24487604 End: 24492395
DescriptionLaccase/Diphenol oxidase family protein
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA1683980
  EVHFYDFIVREKNFTKLCLTKSILVVNDGFPGPEIRVHKGDTVYVNVHNQGDYGLTIHWHGIKQPRNPWSDGPEYITQCPIPPGTNFTYEVILSTEEGTL
  WWHAHSEWTRATVHGAIVILPSAGTTYPFPQPDEDETIIIASWYEGDIKELYDEAMDDGSDLPHSDAYTINGEPGDFCACSKETTYRRTVDYGKTYLLRI
  VNANMNAEHFFAVAEHNLTVVGLDGSYVKPIETSCIVISAGQVMDVLLKANQSPGQYYMAARQYSSEDAEVTGFDHVNVTAILEYRGNYTYQTSPSFPTS
  LPMYLESPAAISFTNRIRSLATPEYPIDVPN
Full Sequence
Protein Sequence     Length: 576     Download
MRLIREEIDI PELESETSES HLEVSYPASS SYPRKNNMKP QKNCSILSTE ILGFLFLLVL    60
FISSVAGEVH FYDFIVREKN FTKLCLTKSI LVVNDGFPGP EIRVHKGDTV YVNVHNQGDY    120
GLTIHWHGIK QPRNPWSDGP EYITQCPIPP GTNFTYEVIL STEEGTLWWH AHSEWTRATV    180
HGAIVILPSA GTTYPFPQPD EDETIIIASW YEGDIKELYD EAMDDGSDLP HSDAYTINGE    240
PGDFCACSKE TTYRRTVDYG KTYLLRIVNA NMNAEHFFAV AEHNLTVVGL DGSYVKPIET    300
SCIVISAGQV MDVLLKANQS PGQYYMAARQ YSSEDAEVTG FDHVNVTAIL EYRGNYTYQT    360
SPSFPTSLPM YLESPAAISF TNRIRSLATP EYPIDVPNIS GVYTTDFPDQ PPTFYNFTEE    420
TFVDDIVFTV QGTKVKMLNY NESVQIVFQG TNVMKGSVNH PMHMHGYSFY VVGFGYGNYD    480
DEADPKGFNF VDPPKVTTFA IPKTGWLAIR FTASNPGVWF WHCHLDRHLS WGMDTAFIVK    540
NGSTTETSIR PPPLYMPPCE PHLNSRIKNS HEIIL*                              600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02191PLN021914.0e-4864538550+
pfam07732Cu-oxidase_33.0e-4876191118+
PLN02604PLN026041.0e-6162537547+
TIGR03388ascorbase5.0e-6785537523+
TIGR03389laccase067559546+
Gene Ontology
GO TermDescription
GO:0005507copper ion binding
GO:0016491oxidoreductase activity
GO:0055114oxidation-reduction process
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1asq_B0685372521A Chain A, Crystal Structure Of The C-Terminal Globular Domain Of Oligosaccharyltransferase (Af_0329) From Archaeoglobus Fulgidus
PDB1asq_A0685372521A Chain A, Crystal Structure Of The C-Terminal Globular Domain Of Oligosaccharyltransferase (Af_0329) From Archaeoglobus Fulgidus
PDB1asp_B0685372521A Chain A, Crystal Structure Of The C-Terminal Globular Domain Of Oligosaccharyltransferase (Af_0329) From Archaeoglobus Fulgidus
PDB1asp_A0685372521A Chain A, Crystal Structure Of The C-Terminal Globular Domain Of Oligosaccharyltransferase (Af_0329) From Archaeoglobus Fulgidus
PDB1aso_B0685372521A Chain A, Crystal Structure Of The C-Terminal Globular Domain Of Oligosaccharyltransferase (Af_0329) From Archaeoglobus Fulgidus
Transmembrane Domains
StartEnd
4466
Hydropathy
Orthologous Group
SpeciesID
Eucalyptus grandisEucgr.B03095.2Eucgr.B03095.1
Fragaria vescamrna20734.1-v1.0-hybrid.27.247mrna20734.1-v1.0-hybrid.27.247
Gossypium raimondiiGorai.009G261100.2
Linum usitatissimumLus10006157.66.252Lus10006157.66.252
Malus domesticaMDP0000258933.484.744MDP0000258933.484.744MDP0000172457
Panicum virgatumPavirv00014086mPavirv00027681m
Ricinus communis28660.m00018828644.m000939
Sorghum bicolorSb05g021890.1
Vitis viniferaGSVIVT01001223001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny