y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna12481.1-v1.0-hybrid
FamilyGH17
Protein PropertiesLength: 228 Molecular Weight: 25472.3 Isoelectric Point: 7.4917
ChromosomeChromosome/Scaffold: 1 Start: 6037636 End: 6038529
Descriptionbeta-1,3-glucanase 5
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH17471781.2e-38
  QSEAVEVMTDIVRFLVLDTDSSLLINVYPYFAYKSDPADVKLDYDLFTTKTLVVQDGPLSYYNLFDAIVDSFYMAMEIVGGHNVTVVVSESGWPSAGSGE
  FNTPELAGTYNRKFIEHISSRVGTPKRPGQYI
Full Sequence
Protein Sequence     Length: 228     Download
MRLFEPNTAA LEALKGSGVS VILGIRNQDL QALAASQEAV KRMVHCQSEA VEVMTDIVRF    60
LVLDTDSSLL INVYPYFAYK SDPADVKLDY DLFTTKTLVV QDGPLSYYNL FDAIVDSFYM    120
AMEIVGGHNV TVVVSESGWP SAGSGEFNTP ELAGTYNRKF IEHISSRVGT PKRPGQYIAG    180
YTSLPCSTRI RNLRARSNIL VFFILTWNLY ILYFRQTRFQ GKLPMNL*                 240
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam00332Glyco_hydro_172.0e-814545+
pfam00332Glyco_hydro_172.0e-4247181135+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2cyg_A7e-3148181149279A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
PDB2cyg_A0.00071453074A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
PDB3f55_D2e-2854214159315A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
PDB3f55_D0.000011393169A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
PDB3f55_C2e-2854214159315A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
Transmembrane Domains
StartEnd
197214
Hydropathy
Orthologous Group
SpeciesID
Arabidopsis lyrata326432.178.280326432.178.280
Picea abiesMA_9530584g0010MA_1673060g0010MA_761919g0010
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny