y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna12575.1-v1.0-hybrid
FamilyGT47
Protein PropertiesLength: 1680 Molecular Weight: 188753 Isoelectric Point: 7.8548
ChromosomeChromosome/Scaffold: 7 Start: 19436993 End: 19446077
Descriptioncellulose synthase-like D3
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT47994090
  LRVYVYDMPSKFTYDLLRLFITSYKDTSNLTSNGSPVHRLIEQHSIDYWLWADLIAPESERLLKSVVRVRRQEEADLFYIPFFTTISFFLMEKQQCKSLY
  REALKWITDQPAWNRSGGRDHIIPVHHPWSFKSVRRSVKNAIWLLPDMDSTGNWYKPGQVYLEKDLILPYVANVDLCDARCVSETQSKRTTLLFFRGRLK
  RNAGGKIRAKLVAELSGAEGVSIEEGTAGEGGKAAAQTGMRKSTFCLNPAGDTPSSARLFDAIVSGCIPVIVSDELELPFEGILDYRKIALFVSSSDAVQ
  PGWLLTYLRNI
Full Sequence
Protein Sequence     Length: 1680     Download
MRKQMARPKS PVLVLTLVLA GLSLLFFILL SFRSSSDGFS SDGPLHPNPI YKPETSFVAS    60
LERFLLAPHN SQTTTHQDPE HVDDERLYSD PYYPLSMPLR VYVYDMPSKF TYDLLRLFIT    120
SYKDTSNLTS NGSPVHRLIE QHSIDYWLWA DLIAPESERL LKSVVRVRRQ EEADLFYIPF    180
FTTISFFLME KQQCKSLYRE ALKWITDQPA WNRSGGRDHI IPVHHPWSFK SVRRSVKNAI    240
WLLPDMDSTG NWYKPGQVYL EKDLILPYVA NVDLCDARCV SETQSKRTTL LFFRGRLKRN    300
AGGKIRAKLV AELSGAEGVS IEEGTAGEGG KAAAQTGMRK STFCLNPAGD TPSSARLFDA    360
IVSGCIPVIV SDELELPFEG ILDYRKIALF VSSSDAVQPG WLLTYLRNIS PAQIEKMRQN    420
LVKYSRHFIY SSPAQPLGPE DLVWRMMAGK LVNIKLHTRR SQRVVKESRS ICTCDCRRPN    480
STTSDQTDLY NNVAIYTFVS TIGGLLHLVS LTASSPTWRW GQLSAATSLN MAGKSFKGTR    540
SNLSSSSDIP DALGKPPIPT VTFGRRTSSG RYISYSRDDL DSEIGSGDFM NYTVHIPPTP    600
DNQPMDPSIS QKVEEQYVSN SLFTGGFNSV TRAHLMDKVI ESETNHPQMA GAKGSSCSIP    660
GCDAKVMSDQ RGEDILPCEC DFKICRDCYT DAVKTGGGVC PGCKEPYKNT DLDEMAMESA    720
LPPLPLPLPN GMSKMERRLS LMKSTKSVLM RSQTGDFDHN RWLFETKGTY GYGNAIWSKE    780
GGLGNGKDDD VVEPTELMNK PWRPLTRKLK IPAAILSPYR LLIFVRMVVL GLFLAWRISN    840
PNTDAMWLWG MSIVCEIWFA FSWLLDQLPK LCPINRSTDL NVLREKFETP TISNPTGKSD    900
LPGIDIFVST ADPDKEPPLV TANTILSILA TDYPVEKLAC YVSDDGGALL TFEAMAEAAS    960
FANIWVPFCR KHAIEPRNPE SYFSLKRDPY KNKVKSDFVK DRRRVKREYD EFKVRINGLP    1020
ESIRRRSDAY HAREEIKAMK LQRQNREDEP VESVKIPKAT WMADGTHWPG TWLTSSAEHS    1080
RSDHAGIIQV MLKPPSDEPL HGADGTIDEA RLIDLTDIDI RLPMLVYVSR EKRPGYDHNK    1140
KAGAMNALVR ASAIMSNGPF ILNLDCDHYI YNSQAMREGM CFMMDRGGDR LCYVQFPQRF    1200
EGIDPSDRYA NHNTVFFDVN MRALDGLQGP VYVGTGCLFR RIALYGFDPP RSKEHHQGCC    1260
SCCFSSRKKN KHASVAHTPE ENRALRMGDS DDEEMNLSLL PKRFGNSTFL IDSIPVAEYQ    1320
GRPLADHPAV KNGRPPGALT IPRELLDAST VAEAISVISC WYEDKTEWGD RVGWIYGSVT    1380
EDVVTGYRMH NRGWKSVYCV TKRDAFRGTA PINLTDRLHQ VLRWATGSVE IFFSRNNALL    1440
ASPRMKLLQR IAYLNVGIYP FTSIFLIVYC FLPALSLFSG QFIVQSLNVT FLTYLLVITL    1500
TLCMLAILEI KWSGIELEEW WRNEQFWLIG GTSAHLAAVI QGLLKVIAGI EISFTLTSKS    1560
GGDDEDDEFA DLYIVKWSSL MIPPITIMMV NLIAIAVGFS RTIYSVIPQW SRLIGGVFFS    1620
FWVLAHLYPF AKGLMGRRGR TPTIVFVWSG LIAITISLLW VAINPPAGAT EIGGSFEFP*    1680
                                                                     1740
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02436PLN024360.00165470856+
PLN02248PLN02248053116791153+
pfam03552Cellulose_synt09041679793+
PLN02915PLN02915064216651116+
PLN02436PLN0243607701665949+
Gene Ontology
GO TermDescription
GO:0016020membrane
GO:0016760cellulose synthase (UDP-forming) activity
GO:0030244cellulose biosynthetic process
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB4hg6_A0.000000413701495330452B Chain B, Structure Of A Cellulose Synthase - Cellulose Translocation Intermediate
PDB1ur6_B0.0026747071649A Chain A, Nmr Based Structural Model Of The Ubch5b-Cnot4 Complex
Transmembrane Domains
StartEnd
1231
816838
845864
14561478
14911510
15251547
15771599
16091631
16441663
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_040_00053.1Aquca_013_00618.5Aquca_030_00332.1Aquca_009_00090.1Aquca_042_00116.2
Aquca_042_00116.1Aquca_023_00060.1Aquca_002_00598.3Aquca_002_00598.2Aquca_002_00598.1
Aquca_013_00618.4Aquca_013_00618.3Aquca_013_00618.2Aquca_013_00618.1
Arabidopsis lyrata482474313939494490338977476604
477609484930909677
Arabidopsis thalianaAT2G35100.1AT5G44930.2AT5G44930.1AT1G67410.1AT3G03650.1
AT1G74680.1AT3G45400.1AT1G34270.1AT5G16890.1
Brachypodium distachyonBradi2g53000.1Bradi1g63740.1Bradi1g24360.1Bradi2g59047.1Bradi4g26150.1
Bradi3g37030.1Bradi5g25660.1
Brassica rapaBra005369Bra023001Bra034000Bra036746Bra004088
Bra031981Bra038288Bra003790Bra023587Bra006378
Bra028047Bra008584
Carica papayaevm.model.supercontig_30.157evm.model.supercontig_43.42evm.model.supercontig_73.11evm.model.supercontig_43.87evm.model.supercontig_111.8
evm.model.supercontig_66.112
Capsella rubellaCarubv10025262mCarubv10026328mCarubv10009012mCarubv10020184mCarubv10016173m
Carubv10017118mCarubv10020282mCarubv10002876mCarubv10015810m
Citrus clementinaCiclev10031603mCiclev10031600mCiclev10015089mCiclev10031340mCiclev10019794m
Ciclev10019803mCiclev10000997mCiclev10019875m
Citrus sinensisorange1.1g014095morange1.1g014048morange1.1g011685morange1.1g011195morange1.1g010594m
orange1.1g011757morange1.1g011167morange1.1g011152m
Cucumis sativusCucsa.056260.1Cucsa.236080.1Cucsa.332740.1Cucsa.090160.1Cucsa.112780.1
Eucalyptus grandisEucgr.B03487.1Eucgr.E04252.1Eucgr.A02153.1Eucgr.K00083.1Eucgr.F02636.1
Eucgr.B00504.1Eucgr.F01298.1
Fragaria vescamrna20016.1-v1.0-hybridmrna27505.1-v1.0-hybridmrna06060.1-v1.0-hybridmrna26011.1-v1.0-hybrid
Glycine maxGlyma19g29730.1Glyma07g34570.1Glyma20g02340.1Glyma03g00910.1Glyma01g07060.1
Glyma17g10840.1Glyma06g20840.2Glyma08g10920.1Glyma04g33600.2Glyma05g27950.1
Glyma11g11550.1Glyma12g02010.3Glyma12g02010.1Glyma20g31360.1Glyma02g12920.2
Glyma10g36230.1Glyma05g01051.1Glyma04g33600.1
Gossypium raimondiiGorai.003G052700.2Gorai.009G332700.2Gorai.009G332700.1Gorai.005G267400.2Gorai.005G267400.1
Gorai.002G184100.2Gorai.005G168600.1Gorai.002G184100.1Gorai.013G196700.1Gorai.004G257200.1
Gorai.007G252800.1Gorai.003G052700.1Gorai.004G113300.1Gorai.005G075900.2Gorai.005G075900.1
Gorai.011G272600.1Gorai.002G184100.3Gorai.002G184100.4
Linum usitatissimumLus10036219Lus10038355Lus10039145Lus10013787Lus10033734
Lus10003870Lus10037016Lus10015791Lus10020308Lus10005684
Lus10002060Lus10031610Lus10013627Lus10024214
Malus domesticaMDP0000223942MDP0000195867MDP0000199026MDP0000175549MDP0000558976
MDP0000482184MDP0000419029MDP0000282146MDP0000266169MDP0000245563
MDP0000693745MDP0000279572MDP0000162640MDP0000200985MDP0000241559
MDP0000206538
Manihot esculentacassava4.1_023143mcassava4.1_006493mcassava4.1_007991mcassava4.1_022793mcassava4.1_032917m
cassava4.1_005963mcassava4.1_006429mcassava4.1_006323mcassava4.1_006525m
Medicago truncatulaMedtr4g078020.1Medtr4g077920.1Medtr3g085480.1Medtr4g084200.1Medtr7g087100.1
Medtr7g087120.1
Mimulus guttatusmgv1a009897mmgv1a010020mmgv1a005660mmgv1a022533mmgv1a004804m
mgv1a005938mmgv1a020908mmgv1a005291mmgv1a019485mmgv1a005764m
Oryza sativaLOC_Os01g59630.1LOC_Os04g57510.1LOC_Os07g37960.1LOC_Os01g69220.1LOC_Os12g03100.1
LOC_Os11g03410.1LOC_Os08g34020.2LOC_Os08g34020.1LOC_Os03g20850.1LOC_Os04g57510.2
Panicum virgatumPavirv00056704mPavirv00014489mPavirv00064353mPavirv00049701mPavirv00020813m
Pavirv00002856mPavirv00019260mPavirv00022063mPavirv00039830mPavirv00041807m
Pavirv00048056mPavirv00007724mPavirv00054522m
Physcomitrella patensPp1s307_10V6.2Pp1s307_10V6.1Pp1s237_53V6.1Pp1s169_88V6.1Pp1s45_211V6.1
Pp1s39_178V6.1Pp1s15_277V6.1Pp1s48_110V6.1Pp1s326_70V6.1Pp1s30_180V6.1
Pp1s106_65V6.1Pp1s34_108V6.1Pp1s34_108V6.2
Phaseolus vulgarisPhvul.002G097200.1Phvul.001G107400.1Phvul.003G190200.1Phvul.004G074100.1Phvul.002G174100.1
Phvul.009G187300.1Phvul.011G019900.1Phvul.007G087100.1
Picea abiesMA_10428894g0010MA_10427831g0010MA_104022g0010MA_168957g0010MA_10429747g0010
MA_10429909g0020MA_362407g0010MA_7513659g0010
Populus trichocarpaPotri.019G049800.3Potri.015G124800.2Potri.015G124800.1Potri.008G034500.1Potri.013G116200.1
Potri.012G124600.1Potri.013G067400.2Potri.013G067400.1Potri.019G044600.2Potri.019G044600.1
Potri.002G210000.1Potri.019G049800.2Potri.019G049800.1Potri.T071700.3Potri.T071700.2
Potri.T071700.1Potri.019G086800.1Potri.005G055000.1Potri.012G135800.1
Prunus persicappa005538mppa004914mppa004491mppa005995mppa004625m
ppa004627m
Ricinus communis29840.m00061530128.m00872829818.m00039330138.m00407929717.m000231
30073.m002257
Setaria italicaSi025194mSi001454mSi029615mSi015706mSi001155m
Si026308mSi010016mSi035588mSi002120m
Selaginella moellendorffii147086857471076759836299588
418827.96.275418827.96.275418827.290.358418827.290.358
Sorghum bicolorSb01g036720.1Sb02g036640.1Sb03g044100.1Sb08g001860.2Sb08g001860.1
Sb03g037670.1Sb07g021480.1Sb06g032380.1
Thellungiella halophilaThhalv10016654mThhalv10000882mThhalv10007515mThhalv10018590mThhalv10018515m
Thhalv10020580mThhalv10002514mThhalv10020554mThhalv10013266m
Vitis viniferaGSVIVT01012106001GSVIVT01014123001GSVIVT01008002001GSVIVT01029936001GSVIVT01036850001
GSVIVT01010454001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)