y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna12591.1-v1.0-hybrid
FamilyGT1
Protein PropertiesLength: 466 Molecular Weight: 50232.6 Isoelectric Point: 5.6443
ChromosomeChromosome/Scaffold: 7 Start: 19513486 End: 19515049
DescriptionUDP-glucosyl transferase 78D2
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT12624316.5e-38
  PQTAEAVAGDGCLSWLDKQKAASVVYVSFGSVTRPSPEELMALAEALEASRVPFLWSLRDNLKNPQLDEFLSKGKLNGMVVPWAPQPQVLAHGSVGAFVT
  HCGWNSVLESVAGGVPLICRPFFGDQKLNARMVEDVWKIGLRLEGGVFTKNGMLKSLDMLLSQDEGAKMK
Full Sequence
Protein Sequence     Length: 466     Download
MAPVSNQVGG HVAVLAFPFS THAAPLLNIV CRLATAAPST LFSFFNTKQS NSSILAGNTS    60
VLRYSNVSVC EVADGVPEGY VFVGKPQEDI ELFMKAAPDN FRRCLEASVA ESGREVSCLV    120
TDAFFWFGAH MADDMGGVPW VPFWTAGPAS LSAHVHTDLI RNTTGGGGHD EKETITVIAG    180
MSKVRPQDLP EGIIFGNLES LFSRMLHQMG QMLPLATAVF INSFEELDPV ITNDLKSKFK    240
RFLNVGPLDL LEPPASAATT TPQTAEAVAG DGCLSWLDKQ KAASVVYVSF GSVTRPSPEE    300
LMALAEALEA SRVPFLWSLR DNLKNPQLDE FLSKGKLNGM VVPWAPQPQV LAHGSVGAFV    360
THCGWNSVLE SVAGGVPLIC RPFFGDQKLN ARMVEDVWKI GLRLEGGVFT KNGMLKSLDM    420
LLSQDEGAKM KNKINTLKQL AQQAVEPKGS STRNFESLLE MTTTN*                   480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02534PLN025342.0e-38207460277+
PLN02210PLN022102.0e-4211459462+
PLN02410PLN024101.0e-4412464467+
PLN02555PLN025558.0e-5110460479+
PLN02448PLN024488.0e-5611464476+
Gene Ontology
GO TermDescription
GO:0008152metabolic process
GO:0016758transferase activity, transferring hexosyl groups
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2c9z_A0114639451A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose
PDB2c1z_A0114639451A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose
PDB2c1x_A0114639451A Chain A, Structure And Activity Of A Flavonoid 3-O Glucosyltransferase Reveals The Basis For Plant Natural Product Modification
PDB3hbj_A014641454A Chain A, Structure And Activity Of A Flavonoid 3-O Glucosyltransferase Reveals The Basis For Plant Natural Product Modification
PDB3hbf_A014641454A Chain A, Structure Of Ugt78g1 Complexed With Myricetin And Udp
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_031_00073.1Aquca_031_00072.1
Arabidopsis lyrata488567326139313693488566
Arabidopsis thalianaAT5G17040.1AT1G30530.1AT5G17050.1AT5G17030.1
Brachypodium distachyonBradi1g46850.1
Brassica rapaBra023594
Carica papayaevm.model.supercontig_95.70
Capsella rubellaCarubv10000798m
Citrus clementinaCiclev10008258mCiclev10019770mCiclev10030331m
Citrus sinensisorange1.1g012893morange1.1g013878m
Cucumis sativusCucsa.092240.1Cucsa.089640.1
Eucalyptus grandisEucgr.A02964.3Eucgr.A02964.1Eucgr.E02976.1Eucgr.E02345.1Eucgr.I02607.1
Eucgr.E02973.1Eucgr.E02977.1Eucgr.C00191.1Eucgr.A02964.2Eucgr.E02398.1
Eucgr.C01022.1Eucgr.C00833.1Eucgr.A00303.1Eucgr.A00306.1Eucgr.C01021.1
Eucgr.C01020.1Eucgr.C01017.1Eucgr.D00702.1Eucgr.C00831.1Eucgr.L02741.1
Eucgr.L02520.1Eucgr.C01063.1Eucgr.E02978.1Eucgr.A00304.1
Fragaria vescamrna30947.1-v1.0-hybridmrna19962.1-v1.0-hybridmrna24693.1-v1.0-hybridmrna11466.1-v1.0-hybridmrna11467.1-v1.0-hybrid
mrna13747.1-v1.0-hybridmrna29614.1-v1.0-hybrid
Glycine maxGlyma07g30200.1Glyma13g01220.1Glyma07g30180.1Glyma08g07130.1Glyma07g30190.1
Glyma13g32910.1Glyma17g07341.1Glyma15g06390.1Glyma06g39350.2Glyma0060s00320.2
Gossypium raimondiiGorai.003G051800.1Gorai.004G101100.1Gorai.012G009400.1Gorai.012G009300.1Gorai.012G009500.1
Gorai.010G063400.1Gorai.009G050700.1Gorai.008G018000.1
Linum usitatissimumLus10025854
Malus domesticaMDP0000543445MDP0000638691MDP0000478252MDP0000405936
Manihot esculentacassava4.1_007209mcassava4.1_031308mcassava4.1_033139mcassava4.1_028603m
Medicago truncatulaMedtr4g128690.1Medtr4g128720.1
Mimulus guttatusmgv1a006133mmgv1a006788m
Oryza sativaLOC_Os06g09240.1LOC_Os07g05420.1
Panicum virgatumPavirv00029337mPavirv00050970mPavirv00041516mPavirv00063020m
Phaseolus vulgarisPhvul.006G201100.1Phvul.002G214500.1Phvul.003G148300.1Phvul.002G214300.1Phvul.002G214400.1
Populus trichocarpaPotri.013G118700.1Potri.018G096000.1Potri.006G171100.1Potri.006G171200.1Potri.013G143900.1
Potri.009G133300.1Potri.009G078400.1Potri.019G090400.1
Prunus persicappa015939mppa019430mppa015221mppa017941mppa005162m
Ricinus communis28479.m00004729804.m00155830073.m002239
Setaria italicaSi006338mSi010039m
Selaginella moellendorffii105043445660
Sorghum bicolorSb10g006140.1Sb02g038860.1
Thellungiella halophilaThhalv10013472m
Vitis viniferaGSVIVT01037410001GSVIVT01037413001GSVIVT01029129001GSVIVT01029126001GSVIVT01029122001
GSVIVT01024419001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)