y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna12962.1-v1.0-hybrid
FamilyCE8
Protein PropertiesLength: 480 Molecular Weight: 52087.7 Isoelectric Point: 9.1044
ChromosomeChromosome/Scaffold: 1 Start: 6637443 End: 6639765
DescriptionPlant invertase/pectin methylesterase inhibitor superfamily
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE81864620
  NVVVAKDGSGNYKTVSEAIQAATGGRFVIYVKAGVYKEKIKTNKDGITLIGDGQYSTIITGDSSVSKAVTGDGFIARDIGFQNTAGPDAEQALALYISSD
  HSVLYKCSIVGYQDTLYALALRQFYRECDIYGSIDFIFGNAAAVFQSCNIVLRRHKGYNAILASGRSDPGQKTGFSVQNCRIVPGSDLSPIKHSYSSYLG
  RPWKDYARAVVMQSNIDDVISPRGWVEWPGSSPKSIYFAEFANVGSGAGVSQRVQWPGFHVIGADVAVEYTVGNFIA
Full Sequence
Protein Sequence     Length: 480     Download
MGLGGSGSGH QDPQHVDIMS ALVNKTIYET RLTSSEFSKF SSQLFEVRDS QPTHDSGSKD    60
YCEELMTMSL KRLEQSLIAL KKSPSKNKQD IQAWLSAALT FQETCKDYAA DHGLSLTSSE    120
NLRLDLSKRI GYTSQLGSNL LALVNRVSSN SDNPKNTTRG KKAEMFPKWV SPKNRKLLQA    180
TTVKANVVVA KDGSGNYKTV SEAIQAATGG RFVIYVKAGV YKEKIKTNKD GITLIGDGQY    240
STIITGDSSV SKAVTGDGFI ARDIGFQNTA GPDAEQALAL YISSDHSVLY KCSIVGYQDT    300
LYALALRQFY RECDIYGSID FIFGNAAAVF QSCNIVLRRH KGYNAILASG RSDPGQKTGF    360
SVQNCRIVPG SDLSPIKHSY SSYLGRPWKD YARAVVMQSN IDDVISPRGW VEWPGSSPKS    420
IYFAEFANVG SGAGVSQRVQ WPGFHVIGAD VAVEYTVGNF IAGTSWLPST GVTFVSGLH*    480
                                                                     540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02201PLN022011.0e-12423478491+
PLN02484PLN024844.0e-12952478458+
PLN02301PLN023015.0e-13815478485+
pfam01095Pectinesterase2.0e-146192463291+
PLN02698PLN02698016479482+
Gene Ontology
GO TermDescription
GO:0004857enzyme inhibitor activity
GO:0005618cell wall
GO:0030599pectinesterase activity
GO:0042545cell wall modification
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1xg2_A01834791316B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein
PDB1gq8_A01794781319A Chain A, Pectin Methylesterase From Carrot
PDB1qjv_B3e-251864375315A Chain A, Pectin Methylesterase Pema From Erwinia Chrysanthemi
PDB1qjv_A3e-251864375315A Chain A, Pectin Methylesterase Pema From Erwinia Chrysanthemi
PDB2ntq_B4e-251864375315A Chain A, Pectin Methylesterase Pema From Erwinia Chrysanthemi
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_055_00025.1Aquca_020_00595.1
Arabidopsis lyrata326467
Arabidopsis thalianaAT5G20860.1
Brassica rapaBra020131
Carica papayaevm.model.supercontig_344.3
Capsella rubellaCarubv10003708m
Citrus clementinaCiclev10007964m
Citrus sinensisorange1.1g011489morange1.1g009545morange1.1g011611morange1.1g009418morange1.1g009682m
Eucalyptus grandisEucgr.C00760.1
Glycine maxGlyma09g08900.2
Gossypium raimondiiGorai.001G018200.1
Linum usitatissimumLus10017665Lus10033621Lus10025510
Malus domesticaMDP0000545023.761.939MDP0000545023.761.939
Manihot esculentacassava4.1_005313mcassava4.1_005427m
Mimulus guttatusmgv1a024664mmgv1a004362m
Phaseolus vulgarisPhvul.009G222700.1
Picea abiesMA_10435891g0010
Populus trichocarpaPotri.006G135100.1Potri.006G135100.2
Prunus persicappa016574m
Ricinus communis29739.m003679
Thellungiella halophilaThhalv10013149m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny