y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna13164.1-v1.0-hybrid
FamilyGT1
Protein PropertiesLength: 178 Molecular Weight: 19768.7 Isoelectric Point: 6.2408
ChromosomeChromosome/Scaffold: 7 Start: 21198347 End: 21204919
DescriptionUDP-glucosyl transferase 88A1
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT151562.5e-30
  HMFLWVVRNSPSHNQSVAITALPDPDLDSLLPDGFLVRTKDRGLVVKSWAPQVAVLNHDSVGGFVSHCGWNSVLEAVCAGVPMVSWPLYVEQRFNRVVLV
  EEIKIALLMNESLDGFVKAVEVEKHFRELMDSEEGESIRMRAKALKSQAKAA
Full Sequence
Protein Sequence     Length: 178     Download
MEERHMFLWV VRNSPSHNQS VAITALPDPD LDSLLPDGFL VRTKDRGLVV KSWAPQVAVL    60
NHDSVGGFVS HCGWNSVLEA VCAGVPMVSW PLYVEQRFNR VVLVEEIKIA LLMNESLDGF    120
VKAVEVEKHF RELMDSEEGE SIRMRAKALK SQAKAALSEG GTYRVALTKL VESWHQG*      180
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02167PLN021673.0e-335172172+
PLN02992PLN029922.0e-332145148+
PLN02554PLN025545.0e-365172176+
PLN00164PLN001641.0e-443177181+
PLN03004PLN030041.0e-527134128+
Gene Ontology
GO TermDescription
GO:0008152metabolic process
GO:0016758transferase activity, transferring hexosyl groups
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2vg8_A3.00018e-422174295467B Chain B, Structural Basis Of Gibberellin(Ga3)-Induced Della Recognition By The Gibberellin Receptor
PDB2vch_A3.00018e-422174295467B Chain B, Structural Basis Of Gibberellin(Ga3)-Induced Della Recognition By The Gibberellin Receptor
PDB2vce_A3.00018e-422174295467A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants
PDB2pq6_A2e-264172324475A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
PDB2acw_B3e-2634172319459A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_007_00152.1Aquca_013_00140.1Aquca_013_00137.1Aquca_012_00157.1Aquca_013_00138.1
Aquca_007_00151.1Aquca_035_00178.1Aquca_035_00180.1
Arabidopsis lyrata496932490463470140470138490956
485420319804479115480763
Arabidopsis thalianaAT4G01070.1AT1G01390.1AT1G01420.1AT4G36770.1AT5G66690.1
AT5G26310.1AT3G50740.1AT2G18570.1AT2G18560.1AT3G16520.3
AT3G16520.2AT3G16520.1
Brachypodium distachyonBradi4g14500.1Bradi1g70370.1Bradi2g49067.1Bradi4g36970.1Bradi2g43810.1
Bradi2g43790.1Bradi3g09180.1Bradi2g49120.1Bradi3g21020.1Bradi2g49057.2
Bradi2g47430.1Bradi2g19160.1Bradi2g19100.1Bradi2g49090.1Bradi2g19170.1
Bradi2g49100.1Bradi2g47420.2Bradi2g47420.1Bradi4g13760.1Bradi2g49110.1
Bradi2g49080.1Bradi2g49057.1Bradi2g19147.1Bradi2g19177.1Bradi3g09190.1
Bradi4g39220.1Bradi1g62500.1
Brassica rapaBra000942Bra037386Bra008540Bra008535Bra033266
Bra012893Bra011705Bra037155Bra012092Bra012892
Bra038862Bra024460Bra028098
Carica papayaevm.model.supercontig_64.59evm.model.supercontig_59.19evm.model.supercontig_59.17evm.model.supercontig_59.18evm.model.supercontig_158.10
evm.model.supercontig_158.11
Capsella rubellaCarubv10003907mCarubv10011054mCarubv10019444mCarubv10006214mCarubv10026316m
Carubv10013620mCarubv10015338mCarubv10016170m
Citrus clementinaCiclev10007122mCiclev10019927mCiclev10011599mCiclev10011601mCiclev10011598m
Ciclev10015042mCiclev10001016mCiclev10020010mCiclev10025462mCiclev10001013m
Ciclev10008085mCiclev10025490mCiclev10027249mCiclev10006910mCiclev10004867m
Ciclev10004863mCiclev10025535m
Citrus sinensisorange1.1g046392morange1.1g045267morange1.1g011381morange1.1g012513morange1.1g011396m
orange1.1g042249morange1.1g012063morange1.1g047445morange1.1g011099morange1.1g046326m
orange1.1g041419morange1.1g043859morange1.1g011608morange1.1g036436morange1.1g045281m
orange1.1g042987morange1.1g044031m
Cucumis sativusCucsa.259040.1Cucsa.259050.1Cucsa.104910.1Cucsa.201450.1
Eucalyptus grandisEucgr.H01249.1Eucgr.L01657.1Eucgr.D02351.1Eucgr.D02353.1Eucgr.D02357.1
Eucgr.D02354.1Eucgr.D02356.1Eucgr.L01659.1Eucgr.H01251.1Eucgr.H01250.1
Eucgr.L01660.1Eucgr.L03088.1Eucgr.H01252.1Eucgr.H01244.1Eucgr.H01241.1
Eucgr.I02471.1Eucgr.F01543.1Eucgr.H01240.1Eucgr.H01242.1Eucgr.I02470.1
Eucgr.H01243.1Eucgr.H01247.1Eucgr.A02703.1Eucgr.C01900.1Eucgr.A02689.1
Eucgr.C01905.1Eucgr.B03865.1Eucgr.C01901.1Eucgr.A02692.1Eucgr.C01902.1
Eucgr.A02709.1Eucgr.A02694.1Eucgr.B03860.1Eucgr.H01245.1Eucgr.A02695.1
Eucgr.A02701.1Eucgr.F02998.1Eucgr.A02693.1Eucgr.F02997.1Eucgr.B03862.1
Eucgr.A02708.1Eucgr.A02706.1Eucgr.A02700.1Eucgr.B03858.1Eucgr.D00095.1
Eucgr.D00097.1Eucgr.D00098.1Eucgr.A02710.1Eucgr.A02713.1Eucgr.C01903.1
Eucgr.L02614.1
Fragaria vescamrna29531.1-v1.0-hybridmrna29534.1-v1.0-hybridmrna29527.1-v1.0-hybridmrna18900.1-v1.0-hybridmrna18903.1-v1.0-hybrid
mrna32055.1-v1.0-hybridmrna32056.1-v1.0-hybridmrna32061.1-v1.0-hybridmrna32062.1-v1.0-hybridmrna15107.1-v1.0-hybrid
mrna13167.1-v1.0-hybridmrna13163.1-v1.0-hybridmrna29533.1-v1.0-hybridmrna29526.1-v1.0-hybridmrna28059.1-v1.0-hybrid
mrna26881.1-v1.0-hybridmrna30501.1-v1.0-hybrid
Glycine maxGlyma08g44720.1Glyma08g44700.1Glyma07g14510.1Glyma03g25020.1Glyma03g25030.1
Glyma16g29330.1Glyma09g23600.1Glyma19g27600.1Glyma09g23330.1Glyma08g48240.1
Glyma06g36520.1Glyma03g41730.1Glyma19g44350.1Glyma07g13560.1Glyma07g13130.2
Glyma07g14530.2Glyma08g44740.1Glyma08g44760.1Glyma08g44710.1Glyma08g44730.1
Glyma08g44690.1Glyma08g44750.1Glyma01g38430.1Glyma0023s00410.2Glyma0023s00410.1
Glyma08g44681.1Glyma03g22640.1Glyma03g25000.1Glyma05g31500.1Glyma11g06880.2
Glyma03g26890.1Glyma09g23750.1Glyma06g36530.1Glyma16g29430.1Glyma03g26980.1
Glyma03g26940.1Glyma16g29380.1Glyma09g23310.1Glyma16g29420.1Glyma16g29400.1
Glyma16g29340.1Glyma09g23720.1Glyma03g03850.1Glyma03g03830.1Glyma12g28270.1
Glyma06g47890.2Glyma16g29370.1Glyma03g03870.1Glyma03g03841.1Glyma03g03861.1
Gossypium raimondiiGorai.001G156000.1Gorai.007G107100.1Gorai.008G124100.1Gorai.004G043400.1Gorai.008G185800.1
Gorai.008G069400.1Gorai.008G069500.1Gorai.003G016800.1Gorai.005G042500.1Gorai.008G069600.1
Gorai.008G273300.1Gorai.008G273200.1Gorai.008G273200.2Gorai.007G340400.1Gorai.001G261800.1
Gorai.001G261700.1Gorai.003G084700.1
Linum usitatissimumLus10001905Lus10003897Lus10005950Lus10029452Lus10029453
Lus10005951Lus10041715Lus10039588Lus10024035Lus10003900
Lus10001906Lus10041713Lus10003944Lus10024037Lus10027542
Lus10039301Lus10039302
Malus domesticaMDP0000875654MDP0000146703MDP0000922723MDP0000316379MDP0000597607
MDP0000128368MDP0000226447MDP0000765050MDP0000315038MDP0000546018
MDP0000164106MDP0000818140MDP0000933711MDP0000129053MDP0000251883
MDP0000318032MDP0000600192MDP0000244946MDP0000128265MDP0000277370
MDP0000242436MDP0000170162MDP0000288715.349.593MDP0000288715.349.593MDP0000277371
MDP0000135820MDP0000248148MDP0000836043MDP0000461555MDP0000688415
MDP0000375160MDP0000219282MDP0000052862MDP0000216076MDP0000517816
Manihot esculentacassava4.1_007352mcassava4.1_006778mcassava4.1_008336mcassava4.1_028991mcassava4.1_034151m
cassava4.1_029183mcassava4.1_006967mcassava4.1_025933mcassava4.1_017099mcassava4.1_007484m
cassava4.1_007441m
Medicago truncatulaMedtr7g047030.1Medtr7g047060.1Medtr8g008970.1.254.442Medtr8g008970.1.254.442Medtr1g019510.1
Medtr8g009070.1.263.449Medtr8g009070.1.263.449Medtr8g009070.1.263.449Medtr1g019520.1Medtr7g046490.1
Medtr8g006270.1Medtr8g008970.1.596.767Medtr8g008970.1.596.767Medtr7g117170.1Medtr7g047110.1
Medtr8g009050.1.740.929Medtr8g009050.1.740.929Medtr5g019580.1Medtr8g009070.1.726.914Medtr8g009070.1.726.914
Medtr8g009070.1.726.914Medtr8g009050.1.255.443Medtr8g009050.1.255.443Medtr7g047230.1Medtr8g008990.1
Medtr6g087160.1AC233783_24.1Medtr8g006220.1Medtr6g023980.1Medtr6g005600.1
Medtr8g006260.1Medtr8g077590.1Medtr8g074550.1
Mimulus guttatusmgv1a005645mmgv1a019456mmgv1a005604mmgv1a020359mmgv1a027171m
mgv1a024118mmgv1a005797mmgv1a023866mmgv1a005593mmgv1a026814m
mgv1a024078mmgv1a006327mmgv1a020496mmgv1a006058m
Oryza sativaLOC_Os11g38650.1LOC_Os01g43280.1LOC_Os05g12450.1LOC_Os02g14540.1LOC_Os01g43270.1
LOC_Os02g14570.1LOC_Os02g14680.1LOC_Os01g50200.1LOC_Os02g14630.1LOC_Os01g53350.1
LOC_Os02g14590.1LOC_Os01g53370.1LOC_Os01g53350.2LOC_Os01g53330.1LOC_Os01g53390.1
LOC_Os05g45150.1LOC_Os05g45200.1LOC_Os01g53420.1LOC_Os01g53460.1LOC_Os01g53430.1
LOC_Os05g45090.1LOC_Os10g07970.1LOC_Os05g45100.1LOC_Os05g45110.1LOC_Os05g45080.1
LOC_Os06g23560.1LOC_Os03g62480.1LOC_Os05g45180.1LOC_Os09g30980.1LOC_Os01g64910.1
Panicum virgatumPavirv00026060mPavirv00005859mPavirv00003341mPavirv00026436mPavirv00043753m
Pavirv00035356mPavirv00051118mPavirv00056590mPavirv00047677mPavirv00004458m
Pavirv00052433mPavirv00012746mPavirv00058890mPavirv00032734mPavirv00039146m
Pavirv00029326mPavirv00010218mPavirv00033651mPavirv00063437mPavirv00058163m
Pavirv00062848mPavirv00058201mPavirv00018682mPavirv00000921mPavirv00013192m
Pavirv00004573mPavirv00031356mPavirv00040548mPavirv00038938mPavirv00044865m
Pavirv00070513mPavirv00067247mPavirv00053631mPavirv00039241mPavirv00030706m
Pavirv00062847mPavirv00033625mPavirv00049902mPavirv00001750mPavirv00017646m
Pavirv00022033mPavirv00051307mPavirv00003392mPavirv00013210mPavirv00035633m
Pavirv00067178mPavirv00062850mPavirv00050738mPavirv00052177mPavirv00058723m
Pavirv00017535mPavirv00062849mPavirv00053720mPavirv00016816mPavirv00006583m
Pavirv00032115mPavirv00070514m
Phaseolus vulgarisPhvul.008G140500.1Phvul.004G104100.1Phvul.008G140600.1Phvul.010G042200.1Phvul.008G140800.1
Phvul.006G111400.1Phvul.009G120600.1Phvul.010G042300.1Phvul.010G042500.1Phvul.010G042400.1
Phvul.004G041000.1Phvul.010G042600.1Phvul.008G140700.1Phvul.002G096500.1Phvul.010G053700.1
Phvul.002G026900.1Phvul.003G021900.1Phvul.005G005500.1Phvul.004G104200.1Phvul.005G005400.1
Phvul.005G005600.1Phvul.005G005600.2Phvul.004G103900.1Phvul.010G071900.1Phvul.010G053500.1
Picea abiesMA_10433602g0010MA_2005g0010MA_79075g0010MA_124563g0010MA_150838g0010
MA_80035g0010MA_334361g0010MA_133989g0010MA_100190g0010MA_108680g0010
MA_35841g0010MA_7897615g0010MA_448422g0010MA_10430887g0020MA_10427806g0010
MA_859383g0010MA_39071g0010MA_202558g0010
Populus trichocarpaPotri.004G069700.1Potri.002G168600.1Potri.014G096100.1Potri.014G096100.2Potri.014G096000.1
Potri.003G138200.1Potri.014G041800.1Potri.007G030400.1Potri.007G030300.1Potri.007G029800.1
Potri.007G030500.1Potri.017G150100.1Potri.015G027700.1Potri.012G035800.1Potri.015G027800.1
Potri.T010800.1Potri.017G150000.1Potri.004G070900.1Potri.004G071000.1Potri.004G070000.1
Potri.004G069600.1Potri.004G069800.1Potri.004G069900.1Potri.004G070800.1Potri.012G036000.1
Prunus persicappa008326mppa005039mppa024809mppa023599mppa020191m
ppa025290mppa015442mppa005112mppa005075mppa015127m
ppa017186mppa005342mppa025073mppa020773m
Ricinus communis28355.m00010230169.m00657630074.m00141829646.m001063
Setaria italicaSi028070mSi026309mSi028025mSi026310mSi004650m
Si001259mSi021923mSi001131mSi016987mSi004742m
Si004522mSi004762mSi033395mSi019234mSi019090m
Si025236mSi039984mSi021912mSi001309mSi025036m
Si001302mSi035416mSi001232mSi001348mSi001290m
Si021955mSi013668mSi001313mSi032267mSi001269m
Si015100mSi001251mSi005201mSi024487mSi039570m
Si007997mSi019420mSi004993mSi024035m
Sorghum bicolorSb10g023110.1Sb05g021870.1Sb05g023250.1Sb05g023240.1Sb04g008700.1.671.968
Sb04g008700.1.671.968Sb09g006910.1Sb03g028190.1Sb04g008700.1.28.463Sb04g008700.1.28.463
Sb02g022260.1Sb02g036220.1Sb03g033810.1Sb02g036210.1Sb09g026310.1
Sb04g003400.1Sb03g033840.1Sb03g032050.1Sb09g026260.1Sb03g034410.2
Sb03g034410.1Sb09g026240.1Sb09g026280.1Sb03g033890.1Sb08g019890.1
Sb03g033870.1Sb03g034130.1Sb01g035800.1Sb09g026250.1Sb07g011880.1
Sb03g033880.1Sb09g026270.1Sb03g033830.1Sb05g017280.1Sb03g033833.1
Sb03g028200.1
Thellungiella halophilaThhalv10010327mThhalv10028623mThhalv10010005mThhalv10010324mThhalv10005518m
Thhalv10025160mThhalv10020674mThhalv10018509mThhalv10022671m
Vitis viniferaGSVIVT01019508001GSVIVT01027064001GSVIVT01009658001GSVIVT01019017001GSVIVT01012581001
GSVIVT01018499001GSVIVT01028807001GSVIVT01026054001GSVIVT01026049001GSVIVT01012577001
GSVIVT01028961001
Zea maysAC206788.3_FGT015
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)