y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna13376.1-v1.0-hybrid
FamilyGH29
Protein PropertiesLength: 489 Molecular Weight: 54871.9 Isoelectric Point: 6.871
ChromosomeChromosome/Scaffold: 7 Start: 22274623 End: 22276515
Descriptionalpha-L-fucosidase 1
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH29413390
  SQLKWQQRELIMFLHFGVNTFTDSEWGTGHESPAIFNPAGLDANQWVKTASDAGISLVVLTAKHHDGFCLWPSKYTEHSVGSSPWRSGHGDVVQELVNAA
  TTHGGIDIGLYLSPWDRHDRRYGHEVAYNQYYLAQLQELLSRYGSVREIWFDGSKGPNAPNMSYYFADWFSMVKELQSTINIFSDAGPDVRWVGNEQGFA
  GSTSWSTINRSSLSIGNASIEGYLNTGDPQGMDWLPPECDVSIRNGWFWHKSESPKKLSTLLEIYYNSVGRNCVLLLNVPPNSTGLISQADVQRLRELR
Full Sequence
Protein Sequence     Length: 489     Download
MAKQWRSLCI FTFLQLSTFT ISRLEQVPTP PLPILPLPTY SQLKWQQREL IMFLHFGVNT    60
FTDSEWGTGH ESPAIFNPAG LDANQWVKTA SDAGISLVVL TAKHHDGFCL WPSKYTEHSV    120
GSSPWRSGHG DVVQELVNAA TTHGGIDIGL YLSPWDRHDR RYGHEVAYNQ YYLAQLQELL    180
SRYGSVREIW FDGSKGPNAP NMSYYFADWF SMVKELQSTI NIFSDAGPDV RWVGNEQGFA    240
GSTSWSTINR SSLSIGNASI EGYLNTGDPQ GMDWLPPECD VSIRNGWFWH KSESPKKLST    300
LLEIYYNSVG RNCVLLLNVP PNSTGLISQA DVQRLRELRG AIDTIFSSNL AENCSIKVSS    360
QRGGKGGGFG PENVLDSDHL WTYWAPKDGD KEEHWIEFRG RDETKGLRFN VIRIQEAIGL    420
GQRIKKHEIY VDGKMVANGT TVGYKRLHRL EGGVLHGQIV RIKLEDSKGL PLISSIGLHF    480
 DPYWHPSV*                                                           540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam01120Alpha_L_fucos1.0e-2876338283+
smart00812Alpha_L_fucos2.0e-3045338339+
COG3669COG36699.0e-6042478452+
Gene Ontology
GO TermDescription
GO:0004560alpha-L-fucosidase activity
GO:0005975carbohydrate metabolic process
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3eyp_B0334795454A Chain A, Crystal Structure Of Putative Alpha-L-Fucosidase From Bacteroides Thetaiotaomicron
PDB3eyp_A0334795454A Chain A, Crystal Structure Of Putative Alpha-L-Fucosidase From Bacteroides Thetaiotaomicron
PDB3ues_B03847419471A Chain A, Crystal Structure Of Alpha-1,34-Fucosidase From Bifidobacterium Longum Subsp. Infantis Complexed With Deoxyfuconojirimycin
PDB3ues_A03847419471A Chain A, Crystal Structure Of Alpha-1,34-Fucosidase From Bifidobacterium Longum Subsp. Infantis Complexed With Deoxyfuconojirimycin
PDB3mo4_B03847421473A Chain A, The Crystal Structure Of An Alpha-(1-3,4)-Fucosidase From Bifidobacterium Longum Subsp. Infantis Atcc 15697
Signal Peptide
Cleavage Site
24
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_013_00507.1Aquca_062_00017.1
Arabidopsis lyrata481700
Arabidopsis thalianaAT2G28100.1
Brachypodium distachyonBradi4g35500.1Bradi5g18220.1
Brassica rapaBra034388
Carica papayaevm.model.supercontig_65.36evm.model.supercontig_3.250
Capsella rubellaCarubv10023050m
Citrus clementinaCiclev10028463m.194.266Ciclev10004832mCiclev10028210mCiclev10028463m.194.266Ciclev10028463m.51.191
Ciclev10028463m.51.191
Citrus sinensisorange1.1g011170morange1.1g047217m
Cucumis sativusCucsa.385790.1Cucsa.193300.1
Eucalyptus grandisEucgr.J00379.2Eucgr.J00379.1Eucgr.J00367.1Eucgr.A02862.1Eucgr.A02861.1
Fragaria vescamrna13375.1-v1.0-hybridmrna28904.1-v1.0-hybrid
Glycine maxGlyma12g30151.1Glyma13g39750.2Glyma10g38670.2Glyma20g29080.1Glyma10g38670.1
Gossypium raimondiiGorai.004G231200.1Gorai.008G282700.1
Linum usitatissimumLus10016140Lus10027390Lus10031681Lus10021427
Malus domesticaMDP0000166406MDP0000271120MDP0000917175MDP0000295518
Manihot esculentacassava4.1_032976mcassava4.1_006636mcassava4.1_007875mcassava4.1_021316m
Medicago truncatulaMedtr1g102230.1Medtr2g095700.1
Mimulus guttatusmgv1a004219mmgv1a005268m
Oryza sativaLOC_Os09g34920.1LOC_Os04g47280.1
Panicum virgatumPavirv00068426mPavirv00016802mPavirv00061161m
Physcomitrella patensPp1s55_131V6.2Pp1s55_131V6.1
Phaseolus vulgarisPhvul.007G063900.1Phvul.005G131200.1
Picea abiesMA_16736g0010MA_171759g0010MA_8122188g0010
Populus trichocarpaPotri.015G133500.1Potri.009G006900.1Potri.012G131400.1
Prunus persicappa023537mppa005337m
Ricinus communis30147.m01415529589.m001240
Setaria italicaSi009874mSi029623m
Selaginella moellendorffii103164236749.37.121236749.37.121415432412246
236951112167158775103375431829
236749.167.333236749.167.333431838103154
Sorghum bicolorSb06g025200.1Sb02g030220.1
Thellungiella halophilaThhalv10016493mThhalv10016468m
Vitis viniferaGSVIVT01018468001.39.381GSVIVT01018468001.39.381GSVIVT01018468001.542.842GSVIVT01018468001.542.842GSVIVT01031495001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)