y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna13503.1-v1.0-hybrid
FamilyAA2
Protein PropertiesLength: 330 Molecular Weight: 35476.4 Isoelectric Point: 8.9434
ChromosomeChromosome/Scaffold: 5 Start: 15304889 End: 15306116
DescriptionPeroxidase superfamily protein
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA2483130
  QTVQKHFKSTPAIAPGLLRMHFHDCFVQGCDASVLLDGATTEKTAGPNRGLRGWEVIDDAKTQLEAACPGVVSCADILALAARDSVVLTKGINWKVPTGR
  LDGRVSLASETSNLPGFRDSIDVQKSKFQALGLNTQDLVTLVGGHTIGTSACQFFRYRLYNFTTTGNGADPTINPSFVPQLRALCPQDGDAAKRVDLDTG
  SAARFDAAFFTNLRNGRGILESDQMLWTDASTKSFVQRFLGVRGLQALNFNVEFGRSMVKMSNIGV
Full Sequence
Protein Sequence     Length: 330     Download
MYQKSSISIL FLALLALATT FPSSVQSQST RVGFYSSSCP RAESIVTQTV QKHFKSTPAI    60
APGLLRMHFH DCFVQGCDAS VLLDGATTEK TAGPNRGLRG WEVIDDAKTQ LEAACPGVVS    120
CADILALAAR DSVVLTKGIN WKVPTGRLDG RVSLASETSN LPGFRDSIDV QKSKFQALGL    180
NTQDLVTLVG GHTIGTSACQ FFRYRLYNFT TTGNGADPTI NPSFVPQLRA LCPQDGDAAK    240
RVDLDTGSAA RFDAAFFTNL RNGRGILESD QMLWTDASTK SFVQRFLGVR GLQALNFNVE    300
FGRSMVKMSN IGVKSATNGE IRRVCSAVN*                                     360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam00141peroxidase0.00125828629+
cd00314plant_peroxidase_like1.0e-2444310302+
pfam00141peroxidase9.0e-6846194150+
cd00693secretory_peroxidase1.0e-16731328301+
PLN03030PLN03030025329305+
Gene Ontology
GO TermDescription
GO:0004601peroxidase activity
GO:0006979response to oxidative stress
GO:0020037heme binding
GO:0055114oxidation-reduction process
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1qo4_A0343297304A Chain A, The 1.9 Angstrom Crystal Structure Of E. Coli Murg
PDB1pa2_A0343297304A Chain A, Arabidopsis Thaliana Peroxidase A2
PDB1sch_B0343296294A Chain A, Peanut Peroxidase
PDB1sch_A0343296294A Chain A, Peanut Peroxidase
PDB3hdl_A0313293303A Chain A, Crystal Structure Of Highly Glycosylated Peroxidase From Royal Palm Tree
Transmembrane Domains
StartEnd
725
Signal Peptide
Cleavage Site
27
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_001_00892.1Aquca_007_00386.1Aquca_007_00388.1Aquca_022_00275.1
Arabidopsis lyrata870602919714919715496608494031
329078316625316622351860920775
Arabidopsis thalianaAT2G41480.1AT5G64110.1AT5G39580.1AT5G64120.1AT5G64100.1
AT4G25980.1AT1G77100.1AT5G39580.2
Brachypodium distachyonBradi2g04490.1Bradi4g22660.1Bradi4g40680.1
Brassica rapaBra000228Bra016930Bra024268Bra031934Bra024269
Bra028436Bra024267Bra013938Bra031933Bra015695
Bra008291
Carica papayaevm.model.supercontig_42.86evm.model.supercontig_468.4evm.model.supercontig_468.3evm.model.supercontig_75.24evm.model.supercontig_49.72
evm.model.supercontig_42.87evm.TU.contig_36964.1evm.model.supercontig_845.4
Capsella rubellaCarubv10023605mCarubv10007711mCarubv10026774mCarubv10026761mCarubv10027924m
Carubv10021650mCarubv10007281m
Citrus clementinaCiclev10008925mCiclev10001751mCiclev10003869m
Citrus sinensisorange1.1g020511morange1.1g045530morange1.1g019638morange1.1g041705m
Cucumis sativusCucsa.217820.1Cucsa.292700.1Cucsa.217830.1Cucsa.345800.1Cucsa.292740.1
Cucsa.292700.2
Eucalyptus grandisEucgr.I02673.1Eucgr.L02460.2Eucgr.L02460.1Eucgr.L02460.4Eucgr.L02460.3
Eucgr.G00658.1Eucgr.F04267.1Eucgr.L01488.1Eucgr.L02460.6Eucgr.L02460.5
Fragaria vescamrna10707.1-v1.0-hybridmrna31037.1-v1.0-hybridmrna02015.1-v1.0-hybridmrna10709.1-v1.0-hybridmrna17058.1-v1.0-hybrid
Glycine maxGlyma08g19170.1Glyma13g23620.2Glyma06g28890.1Glyma15g05810.1Glyma15g05820.1
Glyma08g19180.1Glyma08g19340.1Glyma15g05650.1Glyma1655s00200.1Glyma15g05831.1
Gossypium raimondiiGorai.002G013000.1Gorai.012G141300.1Gorai.005G219200.1Gorai.005G219400.1Gorai.005G219100.1
Gorai.009G017700.2Gorai.009G017700.1Gorai.012G141500.1Gorai.012G141500.2Gorai.002G208800.1
Linum usitatissimumLus10007051Lus10012684Lus10007052Lus10020826Lus10015555
Lus10028631Lus10020421Lus10007050Lus10018929
Malus domesticaMDP0000298078MDP0000198353MDP0000184865MDP0000299137MDP0000515971
MDP0000684133MDP0000136412MDP0000493703MDP0000843352MDP0000527985
MDP0000139136
Manihot esculentacassava4.1_011950mcassava4.1_032385mcassava4.1_024068mcassava4.1_011945mcassava4.1_029449m
Medicago truncatulaMedtr4g114450.1Medtr4g114210.1Medtr2g008710.1Medtr2g008730.1Medtr2g008160.1
Medtr2g008710.2Medtr2g008160.2
Mimulus guttatusmgv1a009839mmgv1a023088mmgv1a019228mmgv1a018852m
Oryza sativaLOC_Os01g07770.1LOC_Os11g10460.1LOC_Os12g08920.1
Panicum virgatumPavirv00006707mPavirv00035647mPavirv00001257mPavirv00018071mPavirv00058650m
Pavirv00013421m
Physcomitrella patensPp1s22_167V6.1Pp1s22_159V6.1
Phaseolus vulgarisPhvul.006G207100.1Phvul.009G197100.1Phvul.003G164600.1Phvul.006G209100.1
Picea abiesMA_93867g0010MA_10426026g0010MA_10429595g0010MA_10434825g0010MA_9805677g0010
Populus trichocarpaPotri.006G069600.1Potri.018G131600.1Potri.016G125000.1
Prunus persicappa008723mppa008667m
Ricinus communis28320.m00113629989.m00043230174.m00915527985.m000888
Setaria italicaSi002216mSi026601mSi010572m
Selaginella moellendorffii10494613291523327112210075799
8986123609714593212686397402
13675973829123452
Sorghum bicolorSb03g004380.1Sb08g005520.1Sb05g009400.1
Thellungiella halophilaThhalv10016924mThhalv10004567mThhalv10004581mThhalv10004557mThhalv10019514m
Thhalv10025604m
Vitis viniferaGSVIVT01015537001GSVIVT01015533001.522.787GSVIVT01015533001.522.787GSVIVT01015533001.49.309GSVIVT01015533001.49.309
GSVIVT01029748001GSVIVT01029771001GSVIVT01029776001GSVIVT01029774001GSVIVT01029775001
GSVIVT01029773001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)