y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna13530.1-v1.0-hybrid
FamilyGT1
Protein PropertiesLength: 489 Molecular Weight: 54553.2 Isoelectric Point: 7.2965
ChromosomeChromosome/Scaffold: 5 Start: 15489661 End: 15491127
DescriptionUDP-glucosyl transferase 73B5
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT12114634e-35
  PCIGVMINTCDELEQPFIEYVSNKLGKPVWGVGPFLPEQYWKSAGSVFYDHKFRTNQKSNVSENEVNKWLDTKPSGSVLYISFGTVVGPSKEEYEMLAEA
  LEASTRSFIWVVRANAGLSTGPSKPSQPDSEPEEAYFPYGLQTRVGNRGLIIRGWAPQLLILSHPSTGGFLSHCGWNSTVEAIGRGVPFLAWPIRGDQHS
  DAKLITSYLKVGYMISKDVSQTIKKENITRGIEKLLNDQEMKQRAVKLSAKFE
Full Sequence
Protein Sequence     Length: 489     Download
MADEIWIVPF FGQGHLFPSM ELCKHLASRN FKTVLVISSK LSSTVPLSLR QYPLVEINEI    60
SEAPPLEPSS QPLHSHHEHH SQIALGLKKL LSTRNHDQSS VRPLYAVVDM KMSWTFDIFN    120
RYEVPAVSFF TSGACSAAVE YAMWKAHPLD VKAGETRLLP GLPEEMAITV SDLKRQIRFP    180
TEPPPQTKFG PERHHPTNPG DKPPWVEAIE PCIGVMINTC DELEQPFIEY VSNKLGKPVW    240
GVGPFLPEQY WKSAGSVFYD HKFRTNQKSN VSENEVNKWL DTKPSGSVLY ISFGTVVGPS    300
KEEYEMLAEA LEASTRSFIW VVRANAGLST GPSKPSQPDS EPEEAYFPYG LQTRVGNRGL    360
IIRGWAPQLL ILSHPSTGGF LSHCGWNSTV EAIGRGVPFL AWPIRGDQHS DAKLITSYLK    420
VGYMISKDVS QTIKKENITR GIEKLLNDQE MKQRAVKLSA KFEHGFPTSS VAALDAFGDF    480
 IRHKGRET*                                                           540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02167PLN021673.0e-364457491+
PLN02448PLN024482.0e-438483525+
PLN02534PLN025342.0e-497454482+
PLN02863PLN028637.0e-535477502+
PLN03007PLN030071.0e-589460490+
Gene Ontology
GO TermDescription
GO:0008152metabolic process
GO:0016758transferase activity, transferring hexosyl groups
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2vg8_A1e-3954529433A Chain A, The Crystal Structure Of Rice (Oryza Sativa L.) Os4bglu12
PDB2vch_A1e-3954529433A Chain A, The Crystal Structure Of Rice (Oryza Sativa L.) Os4bglu12
PDB2vce_A1e-3954529433A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants
PDB2pq6_A5e-36546511459A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
PDB2acw_B8e-29448111458A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_022_00107.1
Citrus clementinaCiclev10003109mCiclev10003233m
Citrus sinensisorange1.1g046077m
Eucalyptus grandisEucgr.E01244.1Eucgr.E01245.1Eucgr.E01246.1Eucgr.D02610.1
Fragaria vescamrna13533.1-v1.0-hybridmrna13529.1-v1.0-hybridmrna09273.1-v1.0-hybrid
Gossypium raimondiiGorai.008G221800.1
Linum usitatissimumLus10007597Lus10012148
Malus domesticaMDP0000193902MDP0000702557MDP0000209283
Manihot esculentacassava4.1_034227m
Medicago truncatulaMedtr5g027210.1
Mimulus guttatusmgv1a023076mmgv1a004898m
Phaseolus vulgarisPhvul.002G132100.1
Picea abiesMA_10434239g0010MA_4725513g0010
Populus trichocarpaPotri.001G133000.1Potri.001G133000.2Potri.003G100500.1Potri.001G133100.1
Prunus persicappa027159mppa003819m
Ricinus communis30131.m00713329827.m002568
Vitis viniferaGSVIVT01022634001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny