y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna13645.1-v1.0-hybrid
FamilyGT8
Protein PropertiesLength: 593 Molecular Weight: 67368 Isoelectric Point: 8.5002
ChromosomeChromosome/Scaffold: 6 Start: 8247216 End: 8252120
Descriptiongalacturonosyltransferase 7
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT82465310
  CLSMRLTVEFFRDPVYDMESLASKYNDPALQHYVIFSTNVLASSVVINSTVMHAKESGKLVFHVLTDQQNYFALKLWFYRNTYKEAIVQVLNLEEIDNRK
  LFLSLPVEFRVSFGIGAEARTEYLSIFSHSHYLLPEIFQKLEKVVVLDEDVVVQQDLSALWSLNMEGKVNAAVQLCSVKLSNLLKSSFDKTSCAWMSGLN
  VIDLVKWRELDLTETYRRFVNEASTQEGQNEAAALHASLLTFKDLIYPLDSVWALSGLGNDYNIDMSAVTKAAVLHYNGKMKPWLD
Full Sequence
Protein Sequence     Length: 593     Download
MAYAGKKRWK GLVVGVLGLV LLSMLVPLLF LLGIHNGFQG YGSEQPNSPT HTTPIIIKES    60
SEEDHVKHVK DIVKHFAPPI FKNSKVEKVE MIDYAKGGID ESGKTCQVKF GSYCLWRQEH    120
KEDMKDFMVK KLKDSLFVAR AYFPTIAKLP SQRKFSSEMK QNIQELEKVL SESTTDADLP    180
SQIEKKLARM QAVIAKAKTF PVECHNVDKK LRQIFDMTAD EAHFHMKQSV FLYQLAVQTM    240
PKSLHCLSMR LTVEFFRDPV YDMESLASKY NDPALQHYVI FSTNVLASSV VINSTVMHAK    300
ESGKLVFHVL TDQQNYFALK LWFYRNTYKE AIVQVLNLEE IDNRKLFLSL PVEFRVSFGI    360
GAEARTEYLS IFSHSHYLLP EIFQKLEKVV VLDEDVVVQQ DLSALWSLNM EGKVNAAVQL    420
CSVKLSNLLK SSFDKTSCAW MSGLNVIDLV KWRELDLTET YRRFVNEAST QEGQNEAAAL    480
HASLLTFKDL IYPLDSVWAL SGLGNDYNID MSAVTKAAVL HYNGKMKPWL DLGIPKYKRF    540
SETVGLRSTN QSISIPSRRM ELPDGQLKLR VTRWGMEGDL MDPGSDLKKN FA*           600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02742PLN027423.0e-71130552469+
PLN02910PLN029103.0e-84111540462+
PLN02718PLN027183.0e-85126540429+
PLN02829PLN028295.0e-91124540448+
PLN02769PLN02769037540532+
Gene Ontology
GO TermDescription
GO:0016757transferase activity, transferring glycosyl groups
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1ga8_A0.000633755858287A Chain A, Structure Of Ugt78g1 Complexed With Myricetin And Udp
PDB1g9r_A0.000633755858287A Chain A, Crystal Structure Of Galactosyltransferase Lgtc In Complex With Mn And Udp-2f-Galactose
Transmembrane Domains
StartEnd
1234
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_004_00589.1Aquca_004_00589.4Aquca_004_00589.2Aquca_004_00589.3Aquca_004_00589.5
Aquca_004_00589.6Aquca_004_00589.7Aquca_004_00589.8Aquca_004_00589.9
Arabidopsis lyrata482874
Arabidopsis thalianaAT2G38650.1AT2G38650.2
Brachypodium distachyonBradi1g63520.1Bradi4g44070.1Bradi1g17570.1Bradi3g61120.1
Brassica rapaBra017110Bra005091Bra000081
Carica papayaevm.model.supercontig_63.51
Capsella rubellaCarubv10022827mCarubv10022960m
Citrus clementinaCiclev10011265mCiclev10011297m
Citrus sinensisorange1.1g006506morange1.1g006959morange1.1g010099m
Cucumis sativusCucsa.002900.3Cucsa.002900.1Cucsa.002900.4
Eucalyptus grandisEucgr.A00881.2Eucgr.A00881.1
Glycine maxGlyma16g09405.1Glyma18g45226.1Glyma09g40610.2
Gossypium raimondiiGorai.005G129100.4Gorai.005G129100.5Gorai.005G129100.2Gorai.006G236100.1Gorai.006G236100.2
Gorai.006G236100.3Gorai.006G236100.4Gorai.005G129100.1Gorai.005G129100.3
Linum usitatissimumLus10003235Lus10035615
Malus domesticaMDP0000922484MDP0000174912
Manihot esculentacassava4.1_005865mcassava4.1_034453m
Medicago truncatulaMedtr7g074680.1
Mimulus guttatusmgv1a002878m
Oryza sativaLOC_Os11g03160.1LOC_Os03g21250.1LOC_Os07g48370.1LOC_Os05g40720.1LOC_Os12g02910.1
Panicum virgatumPavirv00000593mPavirv00014347mPavirv00006239mPavirv00024569mPavirv00069223m
Pavirv00024467mPavirv00048424mPavirv00040432mPavirv00034218mPavirv00014348m
Phaseolus vulgarisPhvul.008G076900.1
Picea abiesMA_118216g0010
Populus trichocarpaPotri.T138200.1Potri.016G144000.1Potri.016G144000.2Potri.006G114300.1Potri.006G114300.2
Potri.006G114300.3Potri.006G114300.4
Prunus persicappa002860m
Ricinus communis30073.m002205
Setaria italicaSi009553mSi029187mSi026080mSi021466mSi034649m
Sorghum bicolorSb09g023760.1Sb01g036430.1Sb02g043170.1Sb08g002010.1
Thellungiella halophilaThhalv10016387mThhalv10016389m
Vitis viniferaGSVIVT01029827001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)