y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna13741.1-v1.0-hybrid
FamilyGH17
Protein PropertiesLength: 286 Molecular Weight: 30507.6 Isoelectric Point: 4.6757
ChromosomeChromosome/Scaffold: 5 Start: 16199961 End: 16205234
DescriptionGlycosyl hydrolase superfamily protein
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH171071925.9e-25
  LLYAQVDAIIYVIKALGFDDIDVKVGETGWSSKGDDNELGACLENAAIYNRNLLKRQMAKEGAPLKPNLYVYIFALFNENKKSGPT
Full Sequence
Protein Sequence     Length: 286     Download
MSLFKALPDP LLFLLKFDGY DESFTGCAST TSDRTSCASG PSHAVFSDMQ LSSYVEAIEV    60
TPTLTVVKEA STLSLAVETL LTLSGHHGGF NAISMTIVEA LTPIPTLLYA QVDAIIYVIK    120
ALGFDDIDVK VGETGWSSKG DDNELGACLE NAAIYNRNLL KRQMAKEGAP LKPNLYVYIF    180
ALFNENKKSG PTSEIFVSGF DRERVKVRSI GEGGTKAYEL LALNTIEAGA RGAAGVDGWM    240
AASSASRAQG LPPWAIEGKN EANPSHSFVQ TLVLDLQHGA YGFPE*                   300
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam00332Glyco_hydro_176.0e-1510719490+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3ur8_B0.000000005106204209306A Chain A, F229aE292S DOUBLE MUTANT OF EXO-Beta-1,3-Glucanase From Candida Albicans In Complex With Laminaritriose At 1.7 A
PDB3ur8_A0.000000005106204209306A Chain A, F229aE292S DOUBLE MUTANT OF EXO-Beta-1,3-Glucanase From Candida Albicans In Complex With Laminaritriose At 1.7 A
PDB3ur7_B0.000000005106204209306A Chain A, Higher-density Crystal Structure Of Potato Endo-1,3-beta-glucanase
PDB3ur7_A0.000000005106204209306A Chain A, Higher-density Crystal Structure Of Potato Endo-1,3-beta-glucanase
PDB4gzj_A0.00000003106204209306A Chain A, Higher-density Crystal Structure Of Potato Endo-1,3-beta-glucanase
Hydropathy