y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna14286.1-v1.0-hybrid
FamilyGH2
Protein PropertiesLength: 1893 Molecular Weight: 209076 Isoelectric Point: 6.4254
ChromosomeChromosome/Scaffold: 7 Start: 7048486 End: 7072325
Descriptionglycoside hydrolase family 2 protein
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH218810620
  FVESLSGYWKFYLASTPGNVPLNFYHTTFQDSEWETLPVPSNWQMHGFDRPIYTNVVYPFPLDPPFVPVDNPTGCYRTDFVIPEEWKGRRVLLHFEAVDS
  AFCAWINGVPVSQDSRLPAEFEITDYCYPCGSDKKNVLAVQVFRWSDGSYLEDQDHWWLSGIHRDVLLLSKPQVEVKIDNSRETSKNTVIDNFTIEAALF
  DSGSWYSIGGSADLLSSNVANLKLDLSPGSILGFRDYSLVGRLEAPRLWSAEQPNLYTLVVILKDKSGNIVDCESCVVGIRQVSNAPKQLLVNGHPIIIR
  GVNRHEHHPRLGKTNIESCMIKDLVLMKQYNINAVRNSHYPQHPRWYELCDIFGMYMIDEANIEAHGFDYSGHVKHPTLEPSWATAMLDRVIGMVERDKN
  HACIISWSLGNESGYGPNHSASAGWVRGKDPSRLLHYEGGGSRTPSTDIICPMYMRVWDIVKIAKDPNETRPLILCEYSHAMGNSNGNIHEYWEAIDSTF
  GLQGGFIWDWVDQGLLKDSADGTKHWAYGGDFGDVPNDLNFCLNGLVWPDRTPHPAMHEVKYVYQPIKVSFSEGTLKELNFPLQVTNTHFYETTRALEFY
  WAAHGDGCELGSGNLSLPLIEPQKTYHIESQSAPWHTLWASSSAEEFFLTITAKLLHSTCWVEAGHVISSTQVQLPVKREFVPHVIKTKDATFLREIVGD
  TLKVSQQNAWEIILNVKMGTVESWKVEGVPLMTKGIFPCFWRAPTDNDKGGGASSYSSKWQAAHIDNLHYITKSCSVENMSDDLLKVAVVFLGVPNSGEG
  SGVEDRSALIEIDVIYTIYSSGDVVVECNVRPNSNLPPLPRVGVEFHLEKSIDQIKWYGRGPFECYPDRKVAAHV
Full Sequence
Protein Sequence     Length: 1893     Download
MPRRVGWSVA GGVCSNPATS GAGPAPTVAR QRLGPGGLGP SFTPIGLGLL GPGRRRTCPF    60
LLVSSVVGYF SGLLPRKIDH SASSYGLQHR DCLVSTSNQA MAAASMMGQL VSPLETGHHV    120
WEDQSFIEWN KRDAHVPLRC HESIEGSLKY WYDRNKVNFM VSDSAPWNDD AVSEALNCAT    180
RWTKGLPFVE SLSGYWKFYL ASTPGNVPLN FYHTTFQDSE WETLPVPSNW QMHGFDRPIY    240
TNVVYPFPLD PPFVPVDNPT GCYRTDFVIP EEWKGRRVLL HFEAVDSAFC AWINGVPVSQ    300
DSRLPAEFEI TDYCYPCGSD KKNVLAVQVF RWSDGSYLED QDHWWLSGIH RDVLLLSKPQ    360
VEVKIDNSRE TSKNTVIDNF TIEAALFDSG SWYSIGGSAD LLSSNVANLK LDLSPGSILG    420
FRDYSLVGRL EAPRLWSAEQ PNLYTLVVIL KDKSGNIVDC ESCVVGIRQV SNAPKQLLVN    480
GHPIIIRGVN RHEHHPRLGK TNIESCMIKD LVLMKQYNIN AVRNSHYPQH PRWYELCDIF    540
GMYMIDEANI EAHGFDYSGH VKHPTLEPSW ATAMLDRVIG MVERDKNHAC IISWSLGNES    600
GYGPNHSASA GWVRGKDPSR LLHYEGGGSR TPSTDIICPM YMRVWDIVKI AKDPNETRPL    660
ILCEYSHAMG NSNGNIHEYW EAIDSTFGLQ GGFIWDWVDQ GLLKDSADGT KHWAYGGDFG    720
DVPNDLNFCL NGLVWPDRTP HPAMHEVKYV YQPIKVSFSE GTLKELNFPL QVTNTHFYET    780
TRALEFYWAA HGDGCELGSG NLSLPLIEPQ KTYHIESQSA PWHTLWASSS AEEFFLTITA    840
KLLHSTCWVE AGHVISSTQV QLPVKREFVP HVIKTKDATF LREIVGDTLK VSQQNAWEII    900
LNVKMGTVES WKVEGVPLMT KGIFPCFWRA PTDNDKGGGA SSYSSKWQAA HIDNLHYITK    960
SCSVENMSDD LLKVAVVFLG VPNSGEGSGV EDRSALIEID VIYTIYSSGD VVVECNVRPN    1020
SNLPPLPRVG VEFHLEKSID QIKWYGRGPF ECYPDRKVAA HVGVYEQKVG DLHVPYIVPG    1080
ECSGRADVRW VTFQNKDGLG IYASIYGSSP PMQMNASYYT TAELDRATHN EDLIRGDDIE    1140
VHLDHKHMGL AGDDSWSPCV HDKSASCQQG NKSRADMKLP LLLLLSAFLA IFASLNPTRQ    1200
WFGWTSPAAD LVVKNAKIYT VDDSLPLADS MAVRSGRVLR IGTYSSIQDM VGYGTKELDL    1260
RGKIVVPGFI DSHVHLIFAG LQMMRVELRG INSKDEFVKR VKEAVKNAKQ GSWILGGGWN    1320
NDLWGGELPL ASWIDDITPY NPVFLSRMDG HMSLANSVAL KLGGITKLSE DPNGGTIMKT    1380
TSGEPTGLLI DSAKELILPL IPEVSVEERR EALRRASDHA LMRGVTTVVD VGRYFPGASV    1440
KDSWEDFSGL RLRDLINNVG QSLSQWIYLG GVKAFADGSV GSRSALFHEP YVDDPHNYGI    1500
QVGDYESLHN LTLASDRAGL QVAIHAIGDR ANDLILNMYE SVISTNGVRD RRFRDVRTDL    1560
KVRTSLRSPP YGSDDGVPPP QQPPAASLIT SPPRRVRRIP IFRRDHPKLQ TKSTSPENWN    1620
SADSPGRESD QGCCSGGGAA SSEPDSQVRT FAPLYGADFP PYGAGEGAPD LAGKLEFGGL    1680
AGDVKWSGKL LGWRRALAGA VRWRTDGNPH RKTVRTSVAE TDCIYSPSWL RTSAPKIEHA    1740
QHLTHGAPAR FGKLGIVASV QSMNKKLGIN RAQKGSYLFQ SLLRSNVELV FGSDWPVVDI    1800
NPLGGIITAM KRIPPGWDIA WAPAESVSLN DSLKAYTLSA ARACFLDGEL GSLSPGKLAD    1860
FVVLSIYSWD DFVAEGSASI NATYVGGIES YP*                                 1920
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd01300YtcJ_like1.0e-9012311547335+
pfam02836Glyco_hydro_2_C2.0e-109474755292+
COG3250LacZ2.0e-1411891060894+
PRK09525lacZ012111611095+
PRK10340ebgA01921163994+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0004565beta-galactosidase activity
GO:0005975carbohydrate metabolic process
GO:0009341beta-galactosidase complex
GO:0016787hydrolase activity
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1f4h_D01891160491001B Chain B, X-Ray Crystal Structure Of Ngt-Bound Hexa
PDB1f4h_C01891160491001B Chain B, X-Ray Crystal Structure Of Ngt-Bound Hexa
PDB1f4h_B01891160491001B Chain B, X-Ray Crystal Structure Of Ngt-Bound Hexa
PDB1f4h_A01891160491001B Chain B, X-Ray Crystal Structure Of Ngt-Bound Hexa
PDB1f4a_D01891160491001A Chain A, E. Coli (Lacz) Beta-Galactosidase (Ncs Constrained Monomer- Orthorhombic)
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_014_00605.1Aquca_014_00605.2
Arabidopsis lyrata485844
Arabidopsis thalianaAT3G54440.1AT3G54440.2AT3G54440.3
Brachypodium distachyonBradi2g61010.1
Brassica rapaBra014816
Carica papayaevm.model.supercontig_540.3
Capsella rubellaCarubv10019396m
Chlamydomonas reinhardtiiCre08.g379450.t1.3
Citrus clementinaCiclev10030068mCiclev10027821m
Citrus sinensisorange1.1g004315morange1.1g004363morange1.1g006933morange1.1g023943morange1.1g023667m
orange1.1g022918morange1.1g007038m
Cucumis sativusCucsa.307940.11Cucsa.307940.1Cucsa.307940.12
Eucalyptus grandisEucgr.J01181.1
Glycine maxGlyma13g26700.1Glyma15g37670.1
Gossypium raimondiiGorai.010G216500.1
Linum usitatissimumLus10024155Lus10039520Lus10039519
Manihot esculentacassava4.1_002723m
Medicago truncatulaMedtr8g039160.1
Mimulus guttatusmgv1a000801m
Oryza sativaLOC_Os01g72340.1
Panicum virgatumPavirv00010284mPavirv00069653m
Physcomitrella patensPp1s130_43V6.1
Phaseolus vulgarisPhvul.011G206800.1
Picea abiesMA_10429668g0010
Populus trichocarpaPotri.003G196500.1Potri.003G196500.2Potri.001G027400.1
Prunus persicappa000508mppa000532m
Ricinus communis30131.m007196
Setaria italicaSi000118mSi000119m
Selaginella moellendorffii181800
Sorghum bicolorSb03g046050.2Sb03g046050.1
Thellungiella halophilaThhalv10010080m
Vitis viniferaGSVIVT01013489001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny