y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna14589.1-v1.0-hybrid
FamilyCE8
Protein PropertiesLength: 1356 Molecular Weight: 149767 Isoelectric Point: 5.7152
ChromosomeChromosome/Scaffold: 1 Start: 7807262 End: 7816333
DescriptionGlycosyl hydrolase family 38 protein
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE8106113420
  VMANGGDFKKISEAIDSIPASNTKRVIIYVGGGVYNEKITIPKNKPFVTLMGDSKNMPNLTFNGDSAKYGTLYSATLSVESDYFVGVNLNIINSSPRPDG
  KKEGAQALALKLSGNKAALYNCQMFGFQDTLCDDQGNHFIKDSYVEGTVDFIFGSGKSLYLNTHINVLGDSGMTVITANAREGDEDKGYSFVHCSITGTG
  SGTFLGRAWRAAPKVTFAYTEMGEVVKPEGWTDNNHPEYDKSVSFGEYKNTGPGSSMSKRVSFTKELSDADAKPFISLGFID
GH38713440
  NVHLVAHSHDDVGWLKTVDQYYVGSNNSIQGACVENTLDSVVESLVRDPNRKFVFAEMAFFQRWWLTQSVEVQERVWKLVDAGQLEFVNGGWCMHDEAAV
  HYIDMIDQTTLGHLAIKQQFNKTPRAGWQIDPFGHSAVQGYLLGAELGFDSVHFARIDYQDRAQRKGDKSLEVIWHGSKTFGSSSQIFANAFPRHYSPPE
  GFHFEVFDDFVPVQDNPLIFDYNVEQRVNDFITAAITQDGRVNALYSTPSLYTDAKNAANQSWPLKTEDYFPYA
Full Sequence
Protein Sequence     Length: 1356     Download
MEPHMVACTD VPFSLYKADP ASGETECAEM LKLAVFFECV IGLIWFLGVV SVDGVYVKYQ    60
TGSGVVEGKL NVHLVAHSHD DVGWLKTVDQ YYVGSNNSIQ GACVENTLDS VVESLVRDPN    120
RKFVFAEMAF FQRWWLTQSV EVQERVWKLV DAGQLEFVNG GWCMHDEAAV HYIDMIDQTT    180
LGHLAIKQQF NKTPRAGWQI DPFGHSAVQG YLLGAELGFD SVHFARIDYQ DRAQRKGDKS    240
LEVIWHGSKT FGSSSQIFAN AFPRHYSPPE GFHFEVFDDF VPVQDNPLIF DYNVEQRVND    300
FITAAITQDG RVNALYSTPS LYTDAKNAAN QSWPLKTEDY FPYADQINAY WTGYFTSRPG    360
LKRYIRSLSG YYLAARELEF LVGKRANGSN TFSLGDALGI AQHHDAATGT AKQHTTNDYV    420
KRLSIGVSEA EAVVSSALLC LTTNKSGDQC KDPAVTFSQC RLLNISFCPP TEEDIPAGKS    480
LVVVAYNPLG WNRTEIVRIP VNDANLVVQD SSGNTLETQY ASVDNVTSNL RTFYTEAYLG    540
KSSKEIPKYW LIFQASVPPL GWDTYFISRG ATGKRRVGLL AVKDSSQNET IDIGPGDLKM    600
SFSSASGQLK RMYNSKTGVD VPIQQSYLWY GSSTAAQASG AYIFRPNGAP PTIVSRSVPF    660
KVFRGPLFDE IHQEFSSWIY QVTRVYRDKE HAEVEYTIGP IPTDDGLGKE VITRMTANMQ    720
TNKVFYTDSN GRDFIERVRD YRADWNLSVN QPVAGNYYPL NLGIFTSDNK SEFSVLVDRA    780
TGGSSIQDGQ VEMMLHRRLL VDDRRGVGEA LDETVCISNN TCQGLTVRGN YYMSINQYGD    840
GAQWRRTTGQ EVYSPLLLAF THENMENWNA SHVTKGSVMD SSYSLPHNVA LITLQELDGG    900
SALLRLAHLY EAGEAPQYST LAKVELKKML TGKTIKELKE MSLSANQEKS GMKKMKWHVE    960
GSTGEEPTPV RGGPVDSSTL VVELGPMEIQ KRMSIHAALM MITTVLLAAT VSMADDPVIP    1020
SDKSAVDKWF QDNVKPLADR KSSLDPDLVK AEDGDPKIVK VMANGGDFKK ISEAIDSIPA    1080
SNTKRVIIYV GGGVYNEKIT IPKNKPFVTL MGDSKNMPNL TFNGDSAKYG TLYSATLSVE    1140
SDYFVGVNLN IINSSPRPDG KKEGAQALAL KLSGNKAALY NCQMFGFQDT LCDDQGNHFI    1200
KDSYVEGTVD FIFGSGKSLY LNTHINVLGD SGMTVITANA REGDEDKGYS FVHCSITGTG    1260
SGTFLGRAWR AAPKVTFAYT EMGEVVKPEG WTDNNHPEYD KSVSFGEYKN TGPGSSMSKR    1320
VSFTKELSDA DAKPFISLGF IDGSKWLLPP PTPKV*                              1380
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02304PLN023042.0e-7910671349293+
cd00451GH38N_AMII_euk2.0e-8570302233+
PLN02682PLN026826.0e-8710661349293+
cd10810GH38N_AMII_LAM_like7.0e-13770305238+
PLN02665PLN0266509941351360+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0004559alpha-mannosidase activity
GO:0005618cell wall
GO:0005975carbohydrate metabolic process
GO:0006013mannose metabolic process
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1hxk_A02881113852A Chain A, Golgi Alpha-Mannosidase Ii In Complex With Deoxymannojirimicin
PDB1hww_A02881113852A Chain A, Golgi Alpha-Mannosidase Ii In Complex With Deoxymannojirimicin
PDB1hty_A02881113852A Chain A, Golgi Alpha-Mannosidase Ii
PDB1ps3_A02881143882A Chain A, Golgi Alpha-mannosidase Ii In Complex With Kifunensine
PDB3eju_A02881143882A Chain A, Golgi Alpha-mannosidase Ii In Complex With Kifunensine
Transmembrane Domains
StartEnd
3557
Hydropathy