y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna14901.1-v1.0-hybrid
FamilyAA4
Protein PropertiesLength: 838 Molecular Weight: 92936.6 Isoelectric Point: 8.6189
ChromosomeChromosome/Scaffold: 1 Start: 8203310 End: 8211339
DescriptionFAD-linked oxidases family protein
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA41123171.2e-24
  ISYFKGVLGEKNVVEDEERLAIANTDWMHKYRGSSKLLLQPRTTEEVSQILKYCDSRSLAVVPQGGNTGLVGGSVPVFDEVVINMSMMNKVISFDKVSGI
  LVCEAGCILENMITYLDNQGFVMPLDLGAKGSCQIGGNVSTNAGGLRLVRYGSLHGTVLGLEVVLANGDVLDMLGTLRKDNTGYDLKHLFIGSEGSLGIV
  TKVSIL
Full Sequence
Protein Sequence     Length: 838     Download
MEKLRATGRL LRYSPKASIF DRRFSPNSGK SIHSSGSGNR HGLGKKCGDE ISRKWNVRTC    60
FGLYGSQGRN LRDCTERGVV EDLRRIEHRG FGSVAEKVQR NASFSTLNSD DISYFKGVLG    120
EKNVVEDEER LAIANTDWMH KYRGSSKLLL QPRTTEEVSQ ILKYCDSRSL AVVPQGGNTG    180
LVGGSVPVFD EVVINMSMMN KVISFDKVSG ILVCEAGCIL ENMITYLDNQ GFVMPLDLGA    240
KGSCQIGGNV STNAGGLRLV RYGSLHGTVL GLEVVLANGD VLDMLGTLRK DNTGYDLKHL    300
FIGSEGSLGI VTKVSILTPP KLFSVNVAFL ACQDYFSCQK LLVEAKRKLG EILSAFEFLD    360
SHALDLVLNH LDGVRNPLPP TIHNFYVLIE TTGSDETFDR EKLEAFLVHA MEGGLISDGA    420
IAQDINQASA FWYIREGIPE ALMKAGAVYK YDLSLPVEKM YDLVDEMRTR LGDSANVVGY    480
GHLGDGNLHL NVSTPQYDDK TLAQIEPFVY EWTSGHRGSI SAEHGLGLMK ANKIFYSKPT    540
ATVKVMASIK KMLDPKGILN PISPNEAYHQ NWKTEPERFP MDNLSFNQAG IMSPNPKLAI    600
MAARTPGKQG ESKGQVKERH VKRRRCIKVL ALSPMKGHFV KIRGVVKPWP PGPFCFLFLF    660
VNTSSHSLIS LFSLSAMTSS SAASRKILSK IACNRLQKEL LEWQVNPPAG FKHKVTDNLQ    720
RWVIEVTGAP GTLYSNETYQ LQVDFPEHYP MEAPQVIFVP PAPMHPHIYS NGHICLDILY    780
DSWSPAMTVS SICISILSML SSSTAKQRPE DNDRYVKNCR NGRSPKETRW WFHDDKV*      840
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam01565FAD_binding_49.0e-37147283137+
PLN02805PLN028051.0e-38112561472+
pfam02913FAD-oxidase_C3.0e-57324561246+
TIGR00387glcD5.0e-71152561419+
COG0277GlcD1.0e-106114561459+
Gene Ontology
GO TermDescription
GO:0003824catalytic activity
GO:0008762UDP-N-acetylmuramate dehydrogenase activity
GO:0016491oxidoreductase activity
GO:0016881acid-amino acid ligase activity
GO:0050660flavin adenine dinucleotide binding
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3pm9_F010656112472A Chain A, Crystal Structure Of A Putative Dehydrogenase (Rpa1076) From Rhodopseudomonas Palustris Cga009 At 2.57 A Resolution
PDB3pm9_E010656112472A Chain A, Crystal Structure Of A Putative Dehydrogenase (Rpa1076) From Rhodopseudomonas Palustris Cga009 At 2.57 A Resolution
PDB3pm9_D010656112472A Chain A, Crystal Structure Of A Putative Dehydrogenase (Rpa1076) From Rhodopseudomonas Palustris Cga009 At 2.57 A Resolution
PDB3pm9_C010656112472A Chain A, Crystal Structure Of A Putative Dehydrogenase (Rpa1076) From Rhodopseudomonas Palustris Cga009 At 2.57 A Resolution
PDB3pm9_B010656112472A Chain A, Crystal Structure Of A Putative Dehydrogenase (Rpa1076) From Rhodopseudomonas Palustris Cga009 At 2.57 A Resolution
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_007_00314.2Aquca_007_00314.4Aquca_007_00314.1Aquca_007_00314.5Aquca_007_00314.3
Arabidopsis lyrata490996
Arabidopsis thalianaAT4G36400.1AT4G36400.2AT5G06580.1
Brachypodium distachyonBradi1g56880.1
Brassica rapaBra017758
Carica papayaevm.model.supercontig_6.186
Capsella rubellaCarubv10006814m
Chlamydomonas reinhardtiiCre10.g434900.t1.3
Citrus clementinaCiclev10025317mCiclev10025522mCiclev10025687m
Citrus sinensisorange1.1g009112morange1.1g011827morange1.1g012299morange1.1g014408morange1.1g014546m
Cucumis sativusCucsa.201090.1Cucsa.201090.2
Eucalyptus grandisEucgr.I02388.1Eucgr.I02389.3Eucgr.I02389.1Eucgr.I02389.2
Glycine maxGlyma01g37490.2Glyma01g37490.3
Gossypium raimondiiGorai.011G100400.1Gorai.011G100400.2
Linum usitatissimumLus10028342Lus10041792
Medicago truncatulaMedtr5g021240.1
Mimulus guttatusmgv1a003621m
Oryza sativaLOC_Os07g06890.1LOC_Os07g08950.1
Panicum virgatumPavirv00006739m
Physcomitrella patensPp1s6_281V6.1Pp1s44_301V6.1
Phaseolus vulgarisPhvul.005G099900.1
Picea abiesMA_159144g0160MA_159128g0010MA_159099g0380
Populus trichocarpaPotri.007G018600.5Potri.007G018600.3Potri.007G018600.1Potri.007G018600.2Potri.007G018600.4
Prunus persicappa003765mppa003656m
Ricinus communis29634.m002061
Setaria italicaSi029317m
Sorghum bicolorSb02g003640.1
Thellungiella halophilaThhalv10024815m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny