y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna14987.1-v1.0-hybrid
FamilyAA2
Protein PropertiesLength: 716 Molecular Weight: 80165.1 Isoelectric Point: 5.595
ChromosomeChromosome/Scaffold: 2 Start: 21531636 End: 21535874
Descriptiondebranching enzyme 1
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA24496950
  GKLLRLLFHDCFVEGCDASVLLQGNGTERSDPANQSLAGFSVIDTAKRLLEILCPRTVSCADIVALAARDAVEITGGPLVHIPTGRRDGKVSSASNVRPN
  IVDTSFTMNEMIKLFSSKGLSLHDLVTLSGAHTIGAAHCSAFSDRFQQDSKGKFRLIDTSLDNGYAEKLMKQCPAGANPSTTVKNDPGTSFVFDNQYYRN
  LLAHRGLFQSDSVLFTDSRSSQQVENFAEDQVNFFESWVQSFLKLTS
Full Sequence
Protein Sequence     Length: 716     Download
MKFAVEGCMH GDLDNVYRTL QHIEKVQNIK IDLLLCCGDF QAVRNEKDLE SLSVPPKYRA    60
MNSFWKYYSG EEIAPYPTIF IGGNHEASNY LWELYYGGWA APNIYFLGFA GVVKFGNIRI    120
GGLSGIYKSR DYRSGHYERP PYNENTIKSV YHVREYDVHK LMQVEEPIHI FLSHDWPLGI    180
TDCGDWKQLV RYKPHFETEV RERTLGSKAA AQLLEKLKPP YWFSAHLHCK FAARVQHGQD    240
GPVTNFLALD KCLPGKKFLQ VLDVDSEPGP YEIQYDEEWL EITRRFNPVF PLTIRSANFG    300
GVHIDKQDYR QWVRSKLQAR GARPFEFSQT APSYNPSNSV SYASLPGYTR NPQTESLLQF    360
LELPYLLDDT SESSEVFKGP FPSSDRDDSE EIPIDDVDEL EELAEEAGDA SCASAHLTLN    420
FYSTSCPSAE LMVRGTVRSA SNIDPTVPGK LLRLLFHDCF VEGCDASVLL QGNGTERSDP    480
ANQSLAGFSV IDTAKRLLEI LCPRTVSCAD IVALAARDAV EITGGPLVHI PTGRRDGKVS    540
SASNVRPNIV DTSFTMNEMI KLFSSKGLSL HDLVTLSGAH TIGAAHCSAF SDRFQQDSKG    600
KFRLIDTSLD NGYAEKLMKQ CPAGANPSTT VKNDPGTSFV FDNQYYRNLL AHRGLFQSDS    660
VLFTDSRSSQ QVENFAEDQV NFFESWVQSF LKLTSTHVKT GDEGEIRTFC ATANT*        720
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam00141peroxidase4.0e-564767832+
pfam00141peroxidase3.0e-57433582151+
PLN03030PLN030309.0e-75421714301+
cd00693secretory_peroxidase8.0e-146416710298+
cd00844MPP_Dbr1_N2.0e-1684259261+
Gene Ontology
GO TermDescription
GO:0004601peroxidase activity
GO:0006397mRNA processing
GO:0006979response to oxidative stress
GO:0016787hydrolase activity
GO:0016788hydrolase activity, acting on ester bonds
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3hdl_A04177152304A Chain A, Crystal Structure Of Highly Glycosylated Peroxidase From Royal Palm Tree
PDB1sch_B04167141294A Chain A, Peanut Peroxidase
PDB1sch_A04167141294A Chain A, Peanut Peroxidase
PDB1bgp_A04177149305A Chain A, Crystal Structure Of Barley Grain Peroxidase 1
PDB1qo4_A04167142304A Chain A, Crystal Structure Of Barley Grain Peroxidase 1
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_016_00365.1
Arabidopsis lyrata328551481340
Arabidopsis thalianaAT4G31760.1AT2G24800.1
Brachypodium distachyonBradi5g14650.1
Brassica rapaBra007831
Capsella rubellaCarubv10006533mCarubv10025481m
Citrus clementinaCiclev10008792m
Citrus sinensisorange1.1g019972m
Cucumis sativusCucsa.271330.1
Eucalyptus grandisEucgr.C04029.1
Glycine maxGlyma17g33730.2Glyma14g12170.1Glyma06g06350.1
Gossypium raimondiiGorai.001G039200.1Gorai.009G064700.2Gorai.009G064700.1Gorai.001G039200.2
Linum usitatissimumLus10026903Lus10020097
Malus domesticaMDP0000289293
Manihot esculentacassava4.1_011556m
Medicago truncatulaMedtr3g105790.1
Mimulus guttatusmgv1a021862m
Panicum virgatumPavirv00013823mPavirv00002787m
Phaseolus vulgarisPhvul.009G085800.1Phvul.001G043100.2Phvul.001G043100.1
Populus trichocarpaPotri.018G015500.1Potri.006G267400.1
Prunus persicappa025451m
Ricinus communis29848.m004502
Setaria italicaSi011734m
Selaginella moellendorffii106106
Sorghum bicolorSb06g021550.1
Thellungiella halophilaThhalv10025685mThhalv10000495m
Vitis viniferaGSVIVT01036009001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny