y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna14993.1-v1.0-hybrid
FamilyGT28
Protein PropertiesLength: 526 Molecular Weight: 57381.9 Isoelectric Point: 8.9596
ChromosomeChromosome/Scaffold: 2 Start: 21556319 End: 21559404
Descriptionmonogalactosyl diacylglycerol synthase 1
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT283455027.3e-32
  VLLMGGGEGMGPIEATARALGDALYDENLGEPMGQVLVVCGRNKKLAEKLRAINWKVPVQVKGFVSKMEECMGACDCIITKAGPGTIAEAMIRGLPIILN
  DYIAGQEVGNVPYVVDNGCGKYSKSPKEIARIVSEWFGPKADELQAMSQNALKLSRPD
Full Sequence
Protein Sequence     Length: 526     Download
MHNSSITTTQ EPGPVYDLVP QLSCRFHGLR SEGPSALLSS FLYFDGPRNP KVTASLSLSS    60
RGGRSSSIRT FVTEFNRAIK FHCHKFPIGF ASLGFGGGDS NGAGAGGDDS INGLRDNGCA    120
LSDNGVASND AVAGNSKKVL ILMSDTGGGH RASAEAIKAA FNQEYGDEYQ VFVTDLWSDH    180
TPWPFNQLPR SYNFLVKHGP LWKMTYYGTA PRLVHQSNFA ATSTFIAREV AKGLMKYQPD    240
IIISVHPLMQ HVPLRVLRQK GLLEKIVFTT VITDLSTCHP TWFHKLVTRC YCPTSEVANR    300
ASKAGLKPSQ IRVYGLPVRP SFVKPVRPKA ELRRELGMEE HLPAVLLMGG GEGMGPIEAT    360
ARALGDALYD ENLGEPMGQV LVVCGRNKKL AEKLRAINWK VPVQVKGFVS KMEECMGACD    420
CIITKAGPGT IAEAMIRGLP IILNDYIAGQ EVGNVPYVVD NGCGKYSKSP KEIARIVSEW    480
FGPKADELQA MSQNALKLSR PDSVFKIVHD MHELVRQRSC VPQYS*                   540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG0707MurG6.0e-29138508380+
PRK13608PRK136085.0e-31135519394+
PRK13609PRK136099.0e-44137514386+
pfam06925MGDG_synth3.0e-74150318169+
PLN02605PLN026050139518382+
Gene Ontology
GO TermDescription
GO:0005975carbohydrate metabolic process
GO:0009058biosynthetic process
GO:0009247glycolipid biosynthetic process
GO:0016758transferase activity, transferring hexosyl groups
GO:0030246carbohydrate binding
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3s2u_A0.0003391516227356A Chain A, Crystal Structure Of The Pseudomonas Aeruginosa Murg:udp-glcnac Substrate Comp
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_016_00340.4Aquca_016_00340.1Aquca_048_00001.3Aquca_048_00001.1Aquca_016_00340.2
Arabidopsis lyrata899522913288488950
Arabidopsis thalianaAT2G11810.1AT4G31780.2AT5G20410.1AT4G31780.1
Brachypodium distachyonBradi4g30600.1Bradi3g54387.1Bradi3g20020.1
Brassica rapaBra023984Bra011297Bra037199Bra020104
Carica papayaevm.model.supercontig_148.42evm.model.supercontig_277.14
Capsella rubellaCarubv10006327mCarubv10013637mCarubv10000862m
Chlamydomonas reinhardtiig14367.t1
Citrus clementinaCiclev10007936mCiclev10007956mCiclev10008213mCiclev10008083m
Citrus sinensisorange1.1g036427morange1.1g012492m
Cucumis sativusCucsa.162930.1Cucsa.132470.1
Eucalyptus grandisEucgr.C04035.1Eucgr.C00320.1Eucgr.C00495.1Eucgr.C04379.1Eucgr.C04035.2
Fragaria vescamrna31719.1-v1.0-hybridmrna30765.1-v1.0-hybrid
Glycine maxGlyma17g33780.1Glyma14g12120.1Glyma13g23150.1Glyma17g11720.1
Gossypium raimondiiGorai.010G119700.2Gorai.001G039100.1Gorai.010G119700.1Gorai.013G236200.1Gorai.009G014700.1
Gorai.009G014700.3
Linum usitatissimumLus10026895Lus10003418Lus10016359Lus10008048
Malus domesticaMDP0000135680MDP0000244574MDP0000214451MDP0000829982MDP0000305295
Manihot esculentacassava4.1_005396mcassava4.1_005397mcassava4.1_006812m
Medicago truncatulaMedtr4g115920.2Medtr4g115920.1
Mimulus guttatusmgv1a004593mmgv1a006191m
Oryza sativaLOC_Os09g25580.1LOC_Os02g55910.2LOC_Os02g55910.1LOC_Os08g20420.1LOC_Os08g20420.2
Panicum virgatumPavirv00042978mPavirv00044523mPavirv00010348mPavirv00051656mPavirv00029899m
Pavirv00008414mPavirv00051657m
Physcomitrella patensPp1s33_287V6.1Pp1s20_66V6.1
Phaseolus vulgarisPhvul.001G042600.1Phvul.003G171300.1
Picea abiesMA_5461g0010
Populus trichocarpaPotri.006G266500.1Potri.018G016600.1Potri.006G063300.3Potri.006G063300.2Potri.006G063300.1
Potri.018G123000.1Potri.006G266500.2
Prunus persicappa003927mppa006453m
Ricinus communis29848.m00450927394.m000347
Setaria italicaSi029462mSi016983mSi015030m
Selaginella moellendorffii271007
Sorghum bicolorSb02g025070.1Sb04g036240.1Sb07g027910.1
Thellungiella halophilaThhalv10024883mThhalv10022676mThhalv10013431m
Vitis viniferaGSVIVT01035995001GSVIVT01012838001
Volvox carteriVocar20009507m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)