y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna15113.1-v1.0-hybrid
FamilyGT77
Protein PropertiesLength: 1214 Molecular Weight: 135191 Isoelectric Point: 7.0617
ChromosomeChromosome/Scaffold: 2 Start: 22149249 End: 22155569
DescriptionNucleotide-diphospho-sugar transferase family protein
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT771924120
  ITNYLVVALDNQIEEFCKANDVPVYRRDPDEGIDSIAKTGGNHAVSGLKFRILREFLQLGYGVLLSDVDIVYLQNPFNHLYRDSDVESMTDGHNNMTAYG
  YNDVFDEPSMGWARYAHTMRIWVYNSGFFYIRPTLPSIELLDRVAGRLSREKAWDQAVFNEELYFPSHPGYDGLHAAKRTMDFYMFMNSKVLFKTVRKDA
  NLKKLKPVILHVNYHPDKLPR
Full Sequence
Protein Sequence     Length: 1214     Download
MAPRRDGSLM RDKAAAQSFR GSRILIAIVV GILLGSVFAF FYPHGFFINS SDDRIAQNWR    60
IGKSDLQSSS QCEPPERIEM LRSEIRELSD KNGELKTQLQ DLTEKLRQAE QGKDHAHEQF    120
SVLGKPHKAG PFGTVKGLRT NPTVTPDESV NPRLAKILEG VAVRKELIVV LANSNVKPML    180
EVQVTTIKKA GITNYLVVAL DNQIEEFCKA NDVPVYRRDP DEGIDSIAKT GGNHAVSGLK    240
FRILREFLQL GYGVLLSDVD IVYLQNPFNH LYRDSDVESM TDGHNNMTAY GYNDVFDEPS    300
MGWARYAHTM RIWVYNSGFF YIRPTLPSIE LLDRVAGRLS REKAWDQAVF NEELYFPSHP    360
GYDGLHAAKR TMDFYMFMNS KVLFKTVRKD ANLKKLKPVI LHVNYHPDKL PRMKAIVEFY    420
INGKQDALEP FPDACGHLVV TEMERFSQRE SILLGYSPQN SFINSGSSPR SSHTNSDIDF    480
HDVFGGPPRR SSSIQETRYS FNDLTGTSTP KGDDDDDDNE RWSEKPVFGE ESHNRRQTHS    540
DDFFDDIFKV SNSVSSSPRR PQRDPYSSSP GSRILSPARP LPPKPEFSLG SSLSAQFSLP    600
AKLTKGADSP PTIGAITRTT SLSRFSSQTF QSPENLKSDV RSSLRMSHLS QDFSATGEGS    660
SNLSKTDKDD TGGTSEQDSK SSGSPTSSNQ FHFSIYRWAS KPMVMPLRGR SGSRVQATRN    720
EEQTSTCEDA GNKILARKSP ISPLPSIDLT SNDHLLPDST SSKLESNKQE NDLLLDESTP    780
NKIEARPGRF TEDTIIPVVE SLETSSSLCS NVADVAGATV SYQWPKKDTN SCQWPKQNSI    840
SCQTSENIEP RPLLQTAGEG PQKKVHVLME QLHKPEIRPT HSLFFDNDLG KGTDEITTLA    900
GNKEVPIKAT KKLSVDVDSS RNEKNQNGKR SSLTNVQVDK SGVQGSLRKL GDNLGRNQVK    960
GTVKDFVKMF NQEASSKPKD DGDLGSQRFK RKEKSPSEPG SEATIITPIM HEELQTSYVK    1020
KTSPDASSAK IIEDLKRSEK DAFEAKKSSF IVNNVPEQYV SAASTADNFL TGSVANCSKA    1080
NIGDADESIH ENFQIEELIQ DEKKPPVVGN NHEELQAIDA KIRQWSKGKE GNIRSLLTTM    1140
QHIVWPESGW KTVPLVEIIE GNAVKRSYQR ALLCLHPDKL QQKGATSQQK YIAEKVFDIL    1200
QEAWNHFNSL GPL*                                                      1260
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam03407Nucleotid_trans1.0e-52192413232+
Gene Ontology
GO TermDescription
GO:0005783endoplasmic reticulum
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3ag7_A0111312136106A Chain A, An Auxilin-Like J-Domain Containing Protein, Jac1 J-Domain
PDB1n4c_A0.00000000000061100121164177A Chain A, Nmr Structure Of The J-Domain And Clathrin Substrate Binding Domain Of Bovine Auxilin
PDB1nz6_B0.000000000000711131211196A Chain A, Crystal Structure Of Auxilin J-Domain
PDB1nz6_A0.000000000000711131211196A Chain A, Crystal Structure Of Auxilin J-Domain
PDB1xi5_R0.0000000000011113121114109J Chain J, Clathrin D6 Coat With Auxilin J-Domain
Transmembrane Domains
StartEnd
2143
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_010_00429.1
Arabidopsis lyrata476651472163476650
Arabidopsis thalianaAT1G19360.1AT1G75120.1AT1G75110.1
Brachypodium distachyonBradi1g15990.1Bradi1g23050.1
Brassica rapaBra016507Bra025734
Carica papayaevm.model.supercontig_62.116evm.model.supercontig_64.63
Capsella rubellaCarubv10021612mCarubv10011112mCarubv10020421mCarubv10021694m
Chlamydomonas reinhardtiiCre12.g552400.t1.3Cre10.g418300.t1.2g11937.t1Cre06.g288500.t1.2Cre02.g111000.t1.2
Citrus clementinaCiclev10001254m
Citrus sinensisorange1.1g014357m
Cucumis sativusCucsa.342160.1Cucsa.240290.1
Eucalyptus grandisEucgr.I01250.1Eucgr.I01251.1Eucgr.I01249.1Eucgr.F01547.1
Fragaria vescamrna02178.1-v1.0-hybrid
Glycine maxGlyma11g12750.1Glyma14g08280.1Glyma12g04930.1Glyma17g36770.2
Gossypium raimondiiGorai.012G146400.1Gorai.012G146400.2Gorai.010G011500.1
Linum usitatissimumLus10026327Lus10032710Lus10042340Lus10018812
Malus domesticaMDP0000152163MDP0000259542MDP0000518381MDP0000208242MDP0000314698
MDP0000242848
Manihot esculentacassava4.1_007950mcassava4.1_008109m
Mimulus guttatusmgv1a006896mmgv1a006728mmgv1a006960m
Oryza sativaLOC_Os07g39840.1
Panicum virgatumPavirv00016039mPavirv00037224mPavirv00044239mPavirv00031762m
Physcomitrella patensPp1s246_43V6.1Pp1s351_31V6.1
Phaseolus vulgarisPhvul.001G015800.1Phvul.011G047000.1
Picea abiesMA_54369g0010
Populus trichocarpaPotri.014G042700.1Potri.014G042700.2Potri.014G042700.3Potri.002G134400.1Potri.009G113300.1
Prunus persicappa006072mppa005997m
Ricinus communis30170.m01400629851.m002438
Setaria italicaSi029932mSi035830m
Selaginella moellendorffii103279431230
Sorghum bicolorSb02g037900.1Sb01g031700.1
Thellungiella halophilaThhalv10007712mThhalv10018600m
Vitis viniferaGSVIVT01009666001GSVIVT01031309001
Volvox carteriVocar20009953mVocar20009597mVocar20012076m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny