y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna15210.1-v1.0-hybrid
FamilyGH35
Protein PropertiesLength: 576 Molecular Weight: 63819.4 Isoelectric Point: 8.4974
ChromosomeChromosome/Scaffold: 2 Start: 22580044 End: 22583307
Descriptionbeta-galactosidase 5
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH3521890
  AMQGFTQKIVQMMKNERLFASQGGPIILSQIENEYGPEVKALGAAGHNYINWAAKMAVGMNTGVPWVMCKEDDAPDPMINACNGFYCDGFTPNKPYKPTL
  WTEAWSGWFSEFGGTVPHRPVQDLAFAVARFIQKGGSYINYYMYHGGTNFGRTAGGPFVTTSYDYDAPIDEYGLIREPKYSHLKALHR
Full Sequence
Protein Sequence     Length: 576     Download
MAMQGFTQKI VQMMKNERLF ASQGGPIILS QIENEYGPEV KALGAAGHNY INWAAKMAVG    60
MNTGVPWVMC KEDDAPDPMI NACNGFYCDG FTPNKPYKPT LWTEAWSGWF SEFGGTVPHR    120
PVQDLAFAVA RFIQKGGSYI NYYMYHGGTN FGRTAGGPFV TTSYDYDAPI DEYGLIREPK    180
YSHLKALHRA IKLSEHALVS SDPTVTSLGT YQQAYVFKGP GSCAAFLSNF HMKSAATVTF    240
NNMHYDLPAW SISILPDCRN AVFNTAKVGV PTSHVHMTPT HSRLLYWETY DEDLSSLHDR    300
SSISTIGLLE QINVTRDTSD YLCVQINSWE SFLHGGKWPT LTVQSAGHAI HVFINGQFSG    360
SAFGTREQTH FTFTGPVNLH AGINRIALLS ITVGLQNGGL HYETWPTGIQ GPVFLDGLSR    420
GRKDLTMQKW FYKVGLNGEA MNLISPSGAS SVDWIRASLA TGNQQLKWYK SYFNAPVGNG    480
PLALDMRSMG KGQVWINGQS IGRYWMAFAK GDCSACSYSG TYREKKCQLG CGRPTQRWYH    540
VPRSWLKPTQ NLLVVFEELG GDPSKITLVE RTVTR*                              600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG1874LacA0.0016182226+
pfam01301Glyco_hydro_357.0e-792191205+
PLN03059PLN0305902575579+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3d3a_A0.00000000000000219187146325A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
PDB3thd_D0.00000000000311276141417A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
PDB3thd_C0.00000000000311276141417A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_014_00261.4Aquca_034_00110.2
Brassica rapaBra013956.94.331Bra015236Bra003370Bra018721Bra013956.94.331
Carica papayaevm.model.supercontig_18.156
Citrus clementinaCiclev10007838mCiclev10004420mCiclev10000553m
Citrus sinensisorange1.1g007315morange1.1g006468morange1.1g004668morange1.1g005404m
Cucumis sativusCucsa.397380.5Cucsa.342700.4Cucsa.256570.2Cucsa.229010.2Cucsa.397380.6
Eucalyptus grandisEucgr.A01556.1.101.314Eucgr.A01556.1.101.314Eucgr.A01181.1
Glycine maxGlyma15g35931.1Glyma09g21980.2.142.289Glyma09g21980.2.142.289Glyma14g07700.3
Gossypium raimondiiGorai.003G059500.4Gorai.011G065300.5Gorai.003G059500.3Gorai.003G059500.2Gorai.013G223000.1.124.295
Gorai.013G223000.1.124.295
Linum usitatissimumLus10023977.605.818
Manihot esculentacassava4.1_029736m
Medicago truncatulaMedtr1g018200.2AC235665_1070.1.117.327AC235665_1070.1.117.327
Mimulus guttatusmgv1a002308m
Oryza sativaLOC_Os03g15020.3
Panicum virgatumPavirv00064750m
Picea abiesMA_217488g0010MA_14774g0010
Populus trichocarpaPotri.007G018100.3Potri.006G144500.6Potri.001G200400.4Potri.001G200400.5
Prunus persicappa002177m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny