y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna15637.1-v1.0-hybrid
FamilyGT41
Protein PropertiesLength: 1031 Molecular Weight: 114406 Isoelectric Point: 6.6937
ChromosomeChromosome/Scaffold: 6 Start: 14628705 End: 14637021
DescriptionTetratricopeptide repeat (TPR)-like superfamily protein
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT414799790
  SIKPNFSQSLNNLGVVYTVQGKMDGAASMIEKAIIANPTYAEAYNNLGVLYRDAGNITMAIDAYEQCLKIDPDSRNAGQNRLLAMNYIHEGHDDKLFVAH
  RDWGRRFMRLFSQYTSWDNIKDPERPLVIGYVSPDYFTHSVSYFIEAPLAHHEYAKYKVVVYSAVVKADAKTIRFRERVLKKGGIWRDIYGIDEKKVASI
  IKEDKVDILVELTGHTANNKLGTMACRPAPVQVTWIGYPNTTGLPAIDYRITDSLADSTDSEQKHVEELVRLPECFLCYTPSPEAGPVSPTPALSNGFIT
  FGSFNNLAKITPKVLQVWARILSAIPNSRLVVKCKPFSCDSVRERFLSTLEQLGLEPLRVDLLPLILLNYDHMQAYSLMDISLDTFPYAGTTTTCESLYM
  GVPCVTMGGSVHAHNVGVSILSKVGLGNLIAKNEEEYVQLAVQLASDITALSNLRMSLRDLMSRSPVCDGPKFTLGLESAYRNMWRRYCKGDVPSKRHME
  M
Full Sequence
Protein Sequence     Length: 1031     Download
MAWTDKDVCN GKDADPVVEN GFLNCSEPSP STSGSLAGAT AERKSFEVKE TISYANILRS    60
RNKFSDALSL YETVLEKDAG NVEAHIGKGI CLQMKNMGRV AFDSFMEAIK LDPENACALT    120
HCGILYKDEG RLREAAESYQ KALKADPSYK PAAECLAIVL TDLGTSLKLA GNTQDGLQKY    180
YEALKTDPHY APAYYNLGVV YSEMMQFDTA LTCYEKAALE RPMYAEAYCN MGVIYKNRGD    240
LESAIACYER CLAVSPNFEI AKNNMAIALT DLGTKARCGA DVHTEEKVRT SLRSPQSGAD    300
DAASSPERTP AASPITFSCR RDRFEGLGSN LHPKLQTRSI TPANWNSADS LGRESDRGRL    360
WCPLGQRRAV IGAGRRRMER RLHFFFGADV RSSSFLCVKL EGDIDQGIAY YKKALYYNWH    420
YADAMYNLGV AYGEMLKFDM AIVFYELAFH FNPHCAEACN NLGVIYKDRD NLDKALALSI    480
KPNFSQSLNN LGVVYTVQGK MDGAASMIEK AIIANPTYAE AYNNLGVLYR DAGNITMAID    540
AYEQCLKIDP DSRNAGQNRL LAMNYIHEGH DDKLFVAHRD WGRRFMRLFS QYTSWDNIKD    600
PERPLVIGYV SPDYFTHSVS YFIEAPLAHH EYAKYKVVVY SAVVKADAKT IRFRERVLKK    660
GGIWRDIYGI DEKKVASIIK EDKVDILVEL TGHTANNKLG TMACRPAPVQ VTWIGYPNTT    720
GLPAIDYRIT DSLADSTDSE QKHVEELVRL PECFLCYTPS PEAGPVSPTP ALSNGFITFG    780
SFNNLAKITP KVLQVWARIL SAIPNSRLVV KCKPFSCDSV RERFLSTLEQ LGLEPLRVDL    840
LPLILLNYDH MQAYSLMDIS LDTFPYAGTT TTCESLYMGV PCVTMGGSVH AHNVGVSILS    900
KVGLGNLIAK NEEEYVQLAV QLASDITALS NLRMSLRDLM SRSPVCDGPK FTLGLESAYR    960
NMWRRYCKGD VPSKRHMEML QQEVSPEEPG TKIAEPIRIT ASGSFTSIKS NGFTPSTPMP    1020
NLCSSEENGV *                                                         1080
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam13844Glyco_transf_413.0e-14605754153+
cd00189TPR2.0e-2115925799+
pfam13844Glyco_transf_411.0e-21777963187+
COG3914Spy6.0e-81439966561+
Gene Ontology
GO TermDescription
GO:0005515protein binding
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB4gz6_D3e-314217558386A Chain A, Crystal Structure Of Udp-Glucosyltransferase Gtfb
PDB4gz6_D2e-23777977524718A Chain A, Crystal Structure Of Udp-Glucosyltransferase Gtfb
PDB4gz6_D2e-181132696155A Chain A, Crystal Structure Of Udp-Glucosyltransferase Gtfb
PDB4gz6_D0.00000000000416028912141A Chain A, Crystal Structure Of Udp-Glucosyltransferase Gtfb
PDB4gz6_D0.000000095519816152A Chain A, Crystal Structure Of Udp-Glucosyltransferase Gtfb
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_058_00216.4.161.321Aquca_058_00216.4.161.321Aquca_058_00216.3.387.547Aquca_058_00216.3.387.547Aquca_058_00216.2
Aquca_058_00216.1.601.761Aquca_058_00216.1.601.761Aquca_072_00077.2Aquca_072_00077.3Aquca_072_00077.1
Arabidopsis lyrata896453.457.745896453.457.745478494
Arabidopsis thalianaAT3G04240.1.457.745AT3G04240.1.457.745AT3G11540.1AT3G11540.2
Brachypodium distachyonBradi3g43577.3.610.769Bradi3g43577.3.610.769Bradi3g43577.2Bradi3g43577.1Bradi5g06647.1.621.781
Bradi5g06647.1.621.781Bradi2g58616.1.592.750Bradi2g58616.1.592.750Bradi3g42910.1
Brassica rapaBra040144.586.743Bra040144.586.743Bra001408Bra034832
Carica papayaevm.model.supercontig_51.46.234.522evm.model.supercontig_51.46.234.522
Capsella rubellaCarubv10012900m.457.745Carubv10012900m.457.745Carubv10013012mCarubv10012928m
Chlamydomonas reinhardtiig13482.t1
Citrus clementinaCiclev10018711m.453.741Ciclev10018711m.453.741Ciclev10011210mCiclev10011021m
Citrus sinensisorange1.1g003557m.291.579orange1.1g003557m.291.579orange1.1g002729m.402.690orange1.1g002729m.402.690orange1.1g002431m.402.690
orange1.1g002431m.402.690orange1.1g005626morange1.1g005594morange1.1g004753morange1.1g007075m
orange1.1g002273morange1.1g003891morange1.1g002443morange1.1g002441morange1.1g002438m
orange1.1g006937morange1.1g007634m
Cucumis sativusCucsa.027630.1.563.753Cucsa.027630.1.563.753Cucsa.083560.1
Eucalyptus grandisEucgr.L00641.1.550.718Eucgr.L00641.1.550.718Eucgr.K02568.1
Fragaria vescamrna16720.1-v1.0-hybrid.551.739mrna16720.1-v1.0-hybrid.551.739
Glycine maxGlyma10g31190.2Glyma10g31190.1.468.756Glyma10g31190.1.468.756Glyma20g36330.1.468.756Glyma20g36330.1.468.756
Glyma20g36330.2Glyma19g38241.2Glyma19g38241.1Glyma03g35610.3Glyma03g35610.2
Glyma02g36210.4Glyma02g36210.3Glyma10g08710.1
Gossypium raimondiiGorai.011G150500.2.480.766Gorai.011G150500.2.480.766Gorai.011G150500.1.481.772Gorai.011G150500.1.481.772Gorai.011G150500.3
Gorai.013G189100.3.376.564Gorai.013G189100.3.376.564Gorai.013G189100.2.571.758Gorai.013G189100.2.571.758Gorai.013G189100.1.571.758
Gorai.013G189100.1.571.758Gorai.011G150500.5.520.693Gorai.011G150500.5.520.693Gorai.011G150500.4.520.693Gorai.011G150500.4.520.693
Gorai.007G367900.2Gorai.007G367900.1Gorai.002G238200.2Gorai.002G238200.1
Linum usitatissimumLus10003576.450.737Lus10003576.450.737Lus10004779.456.744Lus10004779.456.744Lus10003113.456.744
Lus10003113.456.744Lus10021336Lus10017009
Malus domesticaMDP0000233292.459.747MDP0000233292.459.747MDP0000119499MDP0000212192MDP0000846748
Manihot esculentacassava4.1_001015m.583.740cassava4.1_001015m.583.740cassava4.1_002695m.313.473cassava4.1_002695m.313.473cassava4.1_002691m.313.473
cassava4.1_002691m.313.473cassava4.1_001021m.581.740cassava4.1_001021m.581.740cassava4.1_001222mcassava4.1_001239m
cassava4.1_001390m
Medicago truncatulaMedtr1g079510.2.224.512Medtr1g079510.2.224.512Medtr1g079510.1.466.754Medtr1g079510.1.466.754
Mimulus guttatusmgv1a000777m.468.756mgv1a000777m.468.756mgv1a000982m.534.691mgv1a000982m.534.691mgv1a000971m
Oryza sativaLOC_Os01g68680.1.495.747LOC_Os01g68680.1.495.747LOC_Os02g28830.1.255.415LOC_Os02g28830.1.255.415LOC_Os08g44510.1
Panicum virgatumPavirv00063187m.616.777Pavirv00063187m.616.777Pavirv00007611mPavirv00052192m
Physcomitrella patensPp1s263_4V6.1.478.766Pp1s263_4V6.1.478.766Pp1s177_132V6.1.476.764Pp1s177_132V6.1.476.764Pp1s346_18V6.1
Pp1s456_4V6.1Pp1s150_16V6.1
Phaseolus vulgarisPhvul.007G119800.1.469.757Phvul.007G119800.1.469.757Phvul.001G192300.2Phvul.001G192300.1Phvul.007G153100.2
Phvul.007G153100.1
Picea abiesMA_76964g0020.246.533MA_76964g0020.246.533MA_247226g0010.309.469MA_247226g0010.309.469MA_869746g0010
MA_475186g0010MA_261690g0010
Populus trichocarpaPotri.013G051400.7.84.372Potri.013G051400.7.84.372Potri.013G051400.6.224.512Potri.013G051400.6.224.512Potri.013G051400.5
Potri.013G051400.4.463.751Potri.013G051400.4.463.751Potri.013G051400.3.463.751Potri.013G051400.3.463.751Potri.013G051400.2.463.751
Potri.013G051400.2.463.751Potri.013G051400.1.463.751Potri.013G051400.1.463.751Potri.019G025600.5.224.512Potri.019G025600.5.224.512
Potri.019G025600.2.459.747Potri.019G025600.2.459.747Potri.019G025600.1.459.747Potri.019G025600.1.459.747Potri.019G025600.6.213.376
Potri.019G025600.6.213.376Potri.019G025600.4.417.580Potri.019G025600.4.417.580Potri.019G025600.3.478.641Potri.019G025600.3.478.641
Potri.006G208900.1Potri.016G075700.4Potri.016G075700.3Potri.016G075700.1Potri.016G075700.2
Potri.006G208900.3Potri.006G208900.2
Prunus persicappa000862m.459.747ppa000862m.459.747ppa001075m
Ricinus communis29680.m001749.589.74729680.m001749.589.74727556.m00005030032.m00047548742.m000013
Setaria italicaSi016363mSi016197m.619.779Si016197m.619.779Si000265m.480.641Si000265m.480.641
Si013329mSi013225m
Selaginella moellendorffii143846.391.643143846.391.643159012
Sorghum bicolorSb04g019560.1.619.779Sb04g019560.1.619.779Sb07g024110.1
Thellungiella halophilaThhalv10020104mThhalv10020000m.431.719Thhalv10020000m.431.719Thhalv10019996m.457.745Thhalv10019996m.457.745
Thhalv10020052mThhalv10020017m
Vitis viniferaGSVIVT01026359001.593.754GSVIVT01026359001.593.754GSVIVT01033891001
Volvox carteriVocar20006483m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)