y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna15659.1-v1.0-hybrid
FamilyAA3
Protein PropertiesLength: 1115 Molecular Weight: 124199 Isoelectric Point: 8.3525
ChromosomeChromosome/Scaffold: 6 Start: 14774613 End: 14780280
DescriptionLong-chain fatty alcohol dehydrogenase family protein
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA3166750
  QEDSYDAVVVGSGYGGSVAACRLSMAGVRVCLIEKGRKWESQDFPTDVSKILSAFRMENQNLGLSFGPKDALFQVYEQNDSLAAVACGLGGGSLINAGVM
  IPTPVRARCHPKWPKEWERNWDNCEASATAMLKIQSTPVKFPSAKTLEEVAYGELGETFEMSMKLSVNFDIEEPITKGMKPPQMSSCLACGNCLSGCPYN
  AKSSTDKNYILSAIQEGCIVKTECQVKYVVRNLYENFPCERKIVRKNRRWRVYFNEIDYITSDFVILSAGVFGTTEILFQSQMRGLKLSEALGSGFSCNG
  NTVAYLAGSPAPLGAYGLDRKQMFKTPFEKRPGPSITSSYTSSLGFTIQSAVLPTAYPYLLFKGITTYGWPAGYWFFHGIIDKIKHIIGFKACQSMVLIA
  LGHDESDGKITLEKGTNKICFTPPHDPLLPRKIKAFQRLTKKLGGFLFMAKYRSASVHLLGGCNASSDPSHGVCNPDGQVFDPKSPATIHPGLYVCDASL
  IPCSVGINPSLTIATVAEHVSRNLVQDVLMYKSREGLECVLKTPNQDTESFIDRKAINGQRSLVTIRETMRGYIGGMPCTAYLIMKMNSQGQTGSPKWKL
  GNGESHPLLRGKVGGHVEMISFEKDKLHILDGNVNLCAVDDRTPYTQYMHYRLLLAASTG
Full Sequence
Protein Sequence     Length: 1115     Download
MVEKQAAVEE SFGDGQEDSY DAVVVGSGYG GSVAACRLSM AGVRVCLIEK GRKWESQDFP    60
TDVSKILSAF RMENQNLGLS FGPKDALFQV YEQNDSLAAV ACGLGGGSLI NAGVMIPTPV    120
RARCHPKWPK EWERNWDNCE ASATAMLKIQ STPVKFPSAK TLEEVAYGEL GETFEMSMKL    180
SVNFDIEEPI TKGMKPPQMS SCLACGNCLS GCPYNAKSST DKNYILSAIQ EGCIVKTECQ    240
VKYVVRNLYE NFPCERKIVR KNRRWRVYFN EIDYITSDFV ILSAGVFGTT EILFQSQMRG    300
LKLSEALGSG FSCNGNTVAY LAGSPAPLGA YGLDRKQMFK TPFEKRPGPS ITSSYTSSLG    360
FTIQSAVLPT AYPYLLFKGI TTYGWPAGYW FFHGIIDKIK HIIGFKACQS MVLIALGHDE    420
SDGKITLEKG TNKICFTPPH DPLLPRKIKA FQRLTKKLGG FLFMAKYRSA SVHLLGGCNA    480
SSDPSHGVCN PDGQVFDPKS PATIHPGLYV CDASLIPCSV GINPSLTIAT VAEHVSRNLV    540
QDVLMYKSRE GLECVLKTPN QDTESFIDRK AINGQRSLVT IRETMRGYIG GMPCTAYLIM    600
KMNSQGQTGS PKWKLGNGES HPLLRGKVGG HVEMISFEKD KLHILDGNVN LCAVDDRTPY    660
TQYMHYRLLL AASTGSREMT TLYVTFAKVA ERNSKEEKTI LKGELNISMT ELLKSTISLK    720
EDGFIISCKQ WKPHHILSKL KRDEHQNPVL LLNGYSTESY WLPTEANDLV RYLLEEGHDA    780
WLLQPRFHPL NPSNNFTIED VARFDIPAAI NKILELHGPR AKVHVVAHCV GGLAIHMAVM    840
GGHVSATHVA SLSCTNSSMF FKLNAFSRVK MWLPLIPISM FILGEDKTVP LLEISKLTSR    900
HHLLRRIARF IPRYERCTCN ECVVFSGMFG NTFWHENVTP SMHQWLNKQS STRLPMSAFP    960
HLRKICNSGF IVDCNGCNSY LIHPERMALP TLYISGGRSL LVTPQTSFLA HKYMKLHQPG    1020
FRHERVVVEG FGHSDLLIGE ESHKKVFPHI LSHIRLADEG EIYTNRNRCS KEALDWEADQ    1080
HYEGSFGPWG TWFSPFVVVS LFIMLVSLLI LLVL*                               1140
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG3243PhaC0.000474583393+
COG0596MhpC0.00027481033288+
TIGR01838PHA_synth_I9.0e-5745853115+
pfam05199GMC_oxred_C2.0e-1346353472+
COG2303BetA6.0e-1937542582+
Gene Ontology
GO TermDescription
GO:0016614oxidoreductase activity, acting on CH-OH group of donors
GO:0050660flavin adenine dinucleotide binding
GO:0055114oxidation-reduction process
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3cox_A0.000000000175341496A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1
PDB1coy_A0.000000000175341496A Chain A, Crystal Structure Of Cholesterol Oxidase Complexed With A Steroid Substrate. Implications For Fad Dependent Alcohol Oxidases
PDB1b8s_A0.0000000003225438501A Chain A, Cholesterol Oxidase From Streptomyces Glu361gln Mutant
PDB3gyj_A0.00003223168318A Chain A, Cholesterol Oxidase From Streptomyces Glu361gln Mutant
Transmembrane Domains
StartEnd
10911113
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_004_00216.1Aquca_004_00194.1
Citrus clementinaCiclev10011029m
Fragaria vescamrna15657.1-v1.0-hybrid
Gossypium raimondiiGorai.002G238500.1
Manihot esculentacassava4.1_022973m
Prunus persicappa024426m
Ricinus communis28629.m00057128629.m000572
Vitis viniferaGSVIVT01033880001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny