y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna16368.1-v1.0-hybrid
FamilyGH5
Protein PropertiesLength: 499 Molecular Weight: 56591.4 Isoelectric Point: 8.0431
ChromosomeChromosome/Scaffold: 1 Start: 18926646 End: 18929067
Description
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH52124851.69557e-43
  MQDHWNSYITEDDFKFMSSRGLNAVRIPVGWWIAYDPKPPKPFVGGSLKALDNAFIWSQKYELNVIIELHAVQGSQNGLDHSGTRDGHLEFGDSHIPDTL
  KVIDFLAARYAKNPALGAIELMNEPWAPLVTLDTLKKYYKAGYDAVRKHTSSAYVMLANRLGPADSKELLSFAQGLKKVVIDVHYYSMYIDMFKDFSAQQ
  HIDFIYNQRGSDLAAVNISNGPLTYVGEWVAEWGINGAYKQDYQRFAKAQLDVYGRATFGWAYWSYKCENDHWS
Full Sequence
Protein Sequence     Length: 499     Download
MSYFFSLAVY LSCFASLCSA QKLKLPLKSV NLGNWLVVEG WMKPSLFDGI PNKDLLDGTK    60
VQLKSTKLHK YLGAEDGGDS VVVINRTSAS DWETFRLWRI DENSFNFRVT KKKFMGLSRK    120
ETNRIVAVQD QPGDKETFQI VRKEGKPNRI RIQASNGLFL QAKSDTELTA DYEGSGWDDS    180
NPSVFDMIIV GSLKGEYQMT NGYGPDKAPK VMQDHWNSYI TEDDFKFMSS RGLNAVRIPV    240
GWWIAYDPKP PKPFVGGSLK ALDNAFIWSQ KYELNVIIEL HAVQGSQNGL DHSGTRDGHL    300
EFGDSHIPDT LKVIDFLAAR YAKNPALGAI ELMNEPWAPL VTLDTLKKYY KAGYDAVRKH    360
TSSAYVMLAN RLGPADSKEL LSFAQGLKKV VIDVHYYSMY IDMFKDFSAQ QHIDFIYNQR    420
GSDLAAVNIS NGPLTYVGEW VAEWGINGAY KQDYQRFAKA QLDVYGRATF GWAYWSYKCE    480
NDHWSLKWMI ENDYIKIK*                                                 540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd00257Fascin0.000759176118+
pfam00150Cellulase5.0e-12215477277+
COG2730BglC3.0e-26178482342+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1eqp_A1e-3918249226375A Chain A, Exo-B-(1,3)-Glucanase From Candida Albicans
PDB3o6a_A2e-3918249231380A Chain A, F144yF258Y DOUBLE MUTANT OF EXO-Beta-1,3-Glucanase From Candida Albicans At 2 A
PDB2pc8_A2e-3918249232381A Chain A, E292q Mutant Of Exo-B-(1,3)-Glucanase From Candida Albicans In Complex With Two Separately Bound Glucopyranoside Units At 1.8 A
Signal Peptide
Cleavage Site
20
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_010_00111.1Aquca_010_00110.1
Brachypodium distachyonBradi2g31690.1Bradi3g38500.1
Carica papayaevm.model.supercontig_55.63evm.model.supercontig_66.87evm.model.supercontig_20.222
Citrus clementinaCiclev10025463mCiclev10026955mCiclev10025415mCiclev10000913m
Citrus sinensisorange1.1g009560morange1.1g046395morange1.1g019395morange1.1g013777morange1.1g010600m
orange1.1g009475m
Cucumis sativusCucsa.104180.2Cucsa.104180.1
Eucalyptus grandisEucgr.I00417.1Eucgr.L01170.1Eucgr.L02139.1Eucgr.I00543.1Eucgr.I00415.1
Eucgr.F00486.1Eucgr.F00489.1Eucgr.F00489.3Eucgr.F00489.2Eucgr.F00487.1
Eucgr.L01169.1Eucgr.F00488.1Eucgr.I00415.2
Fragaria vescamrna16220.1-v1.0-hybridmrna22085.1-v1.0-hybridmrna16374.1-v1.0-hybrid
Glycine maxGlyma11g37881.1Glyma18g01781.2Glyma18g01781.3Glyma18g01781.1Glyma06g47761.6
Glyma06g47761.1Glyma06g47761.5Glyma06g47761.2Glyma06g47761.8Glyma06g47761.4
Glyma06g47761.7Glyma06g47761.3Glyma13g02030.2Glyma06g47750.1Glyma13g02000.1
Glyma08g14676.1Glyma05g31460.1Glyma14g34450.1
Gossypium raimondiiGorai.009G239600.6Gorai.009G239600.5Gorai.009G239600.4Gorai.009G239600.1Gorai.009G239600.3
Gorai.009G239600.2Gorai.009G239600.7Gorai.011G110800.2Gorai.011G110800.1Gorai.003G041900.1
Gorai.003G044300.1Gorai.003G044000.4Gorai.003G044000.5Gorai.003G044200.1Gorai.003G044000.3
Gorai.003G044000.2Gorai.003G044000.1
Linum usitatissimumLus10041110Lus10036436
Malus domesticaMDP0000319015MDP0000123200MDP0000133367
Manihot esculentacassava4.1_007845mcassava4.1_026104mcassava4.1_006238m
Medicago truncatulaMedtr3g009020.1Medtr3g086750.1Medtr3g009030.1Medtr5g062290.1Medtr3g008960.1
Medtr5g062190.1Medtr3g009010.1Medtr8g091310.1
Mimulus guttatusmgv1a004896mmgv1a019918m
Oryza sativaLOC_Os10g22570.1.193.483LOC_Os10g22570.1.193.483LOC_Os10g22570.1.193.483LOC_Os10g22520.1LOC_Os10g22570.1.671.954
LOC_Os10g22570.1.671.954LOC_Os10g22570.1.671.954LOC_Os05g15510.2LOC_Os05g15510.1LOC_Os08g37750.1
Panicum virgatumPavirv00046245mPavirv00011301mPavirv00018291mPavirv00046244mPavirv00011300m
Pavirv00028658mPavirv00000970mPavirv00042459mPavirv00046564m
Physcomitrella patensPp1s304_43V6.1
Phaseolus vulgarisPhvul.001G254400.1Phvul.008G171300.1Phvul.002G261800.1Phvul.008G171400.1
Picea abiesMA_10427061g0010MA_479818g0010MA_4911g0010MA_14445g0010MA_23595g0010
Populus trichocarpaPotri.007G010000.1Potri.005G167800.1Potri.007G089400.1Potri.007G089400.2Potri.005G078500.1
Potri.002G093000.1
Prunus persicappa023601mppa005425mppa019648m
Ricinus communis29810.m00014529908.m00599427889.m00017327905.m00007336339.m000016
Setaria italicaSi035257mSi006205mSi021695mSi021671mSi039329m
Si013558mSi035337m
Selaginella moellendorffii12682742658240418324801
Sorghum bicolorSb10g007500.1Sb09g008170.1Sb01g024390.1Sb10g008480.1
Vitis viniferaGSVIVT01003438001GSVIVT01006372001GSVIVT01006369001GSVIVT01002801001GSVIVT01008995001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)